KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A0918Help
Entry
BURPS1106A_A0918  CDS       T00480                                 

Gene name
asnB
Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BURPS1106A_A0918 (asnB)
Enzymes [BR:bpl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BURPS1106A_A0918 (asnB)
Peptidases [BR:bpl01002]
 Cysteine Peptidases
  Family C44
   BURPS1106A_A0918 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:896735..898705
Genome map
AA seq 656 aa AA seqDB search
MCGITGFVGPVACAPQTARATLARMTDSLAHRGPDDTGLWIDHDAGVALGHRRLSIVDLS
EHGHQPMLSACGRYAMTFNGEIYNFRELRGELEREHRAPEWRGHSDSEVLLAAFCAWGVD
RALQKAVGMFALALWNRESRVLTLARDRIGEKPLYYGRIGGSFVFGSELKALRRFPGFDA
HPIDRDALCLYLRHASVPAPYTIYEGIRKLPPGTYAQLEDLAEAPAPRRYWSLERAIAAG
RANPFDGDANAAVAQLDHVLRDAIAEQSVADVPLGAFLSGGVDSSVIVALMQTQTAQPVQ
TFTIGFHEAGYDEAGYAKAVARHLGTSHTELYVKPADVLATVPRMPCVYDEPFADSSQIP
TLLVSELTRRHVKVSLSGDGGDELFGGYTRYFLTPRLWGRLRRVPAAVRMRIAAALHALR
PDHADQIASLVQGAWSASAQRDASPRVGDRLHKLANVMTADSRASLYRLLMSSVHHPERF
TLAGHEPQTLIDTPGAWPAGLSFAEQAMAVDTLTYLPTDILTKVDRAAMAVSLETRMPFL
DHRVVEFAWRLPEALRIPDGQDKWLLRKLLYRYVPRPLIDRPKQGFCAPVGAWLRGELSD
WAAELLRPARLRDEGYLDAARVERLWRQHQSGRMNWQHPLWTVLMFQAWLERQRAE
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcaccggcttcgtgggccctgtcgcatgcgcgccgcagacggctcgcgcg
accctcgcgcgaatgacggacagtctcgcgcatcgcggcccggacgataccggtttgtgg
atcgatcacgacgcgggcgtcgcgctcggccatcggcgcctgtcgatcgtcgacttgtcc
gagcacgggcatcagccgatgctgtccgcgtgcggccgttatgcgatgacgttcaacggc
gagatctacaactttcgcgagttgcgcggcgagctcgagcgcgagcatcgcgcgcccgaa
tggcgcggtcattcggatagcgaagtgttgctcgcggcgttctgcgcgtggggcgtcgat
cgcgcgttgcaaaaggcggtcggcatgttcgcgctcgcgctgtggaaccgcgaatcgcgc
gtgctcacgctcgcgcgcgatcgcatcggcgagaagccgctctattacggccgcatcggc
ggctcgttcgtgttcggctccgagctgaaggcactgcggcgttttcccggcttcgacgcg
catccgatcgaccgcgacgcgctgtgcctgtatctgcgccacgcgagcgtgcccgcgccg
tacacgatctacgaaggcatccgcaagctgccgcccggcacgtacgcgcagctcgaggac
ctcgccgaagcgcccgcgccgcgccgctactggtcgctcgagcgcgcgatcgccgcaggc
cgcgcgaatccgttcgacggcgacgcgaacgccgccgtcgcgcagctcgatcacgtgttg
cgcgacgcgatcgccgagcagtcggtcgccgacgtgccgctcggcgcgttcctgtcgggc
ggcgtcgattcgtcggtgatcgtcgcgctgatgcagacgcagaccgcgcagccggtgcag
accttcacgatcggctttcacgaggcgggctacgacgaggccggctatgcgaaggcggtt
gcgcggcatctgggcacgtcgcacaccgagctctacgtgaagccggccgacgtgctcgcg
accgtcccgcgcatgccgtgcgtctacgacgagccgttcgccgattcgtcgcagattccg
acgctgctcgtctccgagctcacccgccggcacgtgaaggtgagcctgtccggcgacggc
ggtgacgagctgttcggcggctacacgcgttatttcctgacgccgcgcctatgggggcgg
ctgcgccgcgtgccggccgcggtgcggatgcggatcgcggccgcgctgcacgcgctgcgg
cccgaccatgcggatcagatcgcctcgctcgtgcagggcgcgtggagcgcgtccgcgcag
cgcgacgcgtcgccgcgcgtcggggaccgcctgcacaagctcgcgaacgtgatgacggcg
gacagccgcgcgtcgctgtaccggttgctgatgtcgtcggtccatcatccggagcgcttc
acgctcgcggggcacgagccgcagacgctgatcgacacgccgggcgcgtggcccgccggg
ctgtcgttcgccgagcaggccatggccgtcgatacgctcacgtatctgccgaccgacatc
ctgacgaaagtcgaccgcgcggcgatggcggtgagcctcgagacgcggatgccgtttctc
gatcaccgcgtcgtcgagttcgcgtggcggctgccggaggcgctgcgcatcccggatggg
caggacaagtggttgctgcgcaagctgctgtatcgctacgtgccgcgcccgctgatcgac
cggccgaaacagggcttctgcgcgcccgtcggcgcgtggctgcgcggcgaattgagcgac
tgggcggcggagctgctgcgccccgcgcgcctgcgcgacgaaggctacctcgacgcggcg
cgcgtcgagcgcctgtggcggcagcaccagtcgggccggatgaactggcagcacccgctc
tggacggtgctgatgttccaggcatggctcgagcggcagcgcgccgagtag

DBGET integrated database retrieval system