KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A1358Help
Entry
BURPS1106A_A1358  CDS       T00480                                 

Definition
putative UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bpl00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bpl00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
II:complement(1283668..1284969)
Genome map
AA seq 433 aa AA seqDB search
MSNLIVHGGAPLRGEITPSANKNAVLPILCATLLTDRPLRLVGVPDITDVRKILDIFRTL
GSDVSIDYASGVLDLHHRATAFDPAVHRLPEEMRSSIMLVPPLLARFGVARLENDVKGCT
LGVREIDPHVEVFERFGARIERTSDSLIVRADGPLTPNHHWLDYASVTTTENFVLCAASA
NGTSTLVNAASEPHVQEFCRFLAMLGVPIEGIGTSHLSVQGGRALAGGEYRFNEDFHEIA
TFLALGAITGGDIAVRNGSPEQFPLIDRTFAKFGVQVTHENGWSHALRDGPLKVKQPFTR
NILTKVEAAPWPYLPVDLLPIFIALGVQAQGSVMFWNKVYDGAMGWTGELSKFGAHVFLS
DPHRLITFGGLPLSPARVESPYIIRVAIALLMVAASIDGRSEILNAQPIRRAHPHFVENL
RSVGANVEWTSGE
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacctgatcgtccacggcggcgccccgcttcgcggagaaatcacgccgtccgcc
aacaagaacgccgtcctgcccatcctgtgcgcgacgctcctcaccgaccggccgctgcgg
ctcgtcggcgtgccggacatcaccgacgtgcgcaaaatcctcgacatcttccgcacgctc
ggcagcgacgtctcgatcgattacgcgagcggcgtgctcgatctgcaccatcgcgcgacc
gcgttcgatccggccgtccaccggctgccggaggagatgcgctcgtcgatcatgctggtg
ccgccgctgctcgcgcgcttcggcgtcgcgcggctcgagaacgacgtaaagggctgcacg
ctcggcgtgcgcgagatcgatccgcacgtcgaagtgttcgagcgcttcggcgcgcgcatc
gagcgcacgtccgattcgctgatcgtgcgcgccgacggcccgctcacgccgaatcatcac
tggctcgactacgcgtccgtcacgacgaccgagaacttcgtgctgtgcgccgcgtcggcg
aacggcacgtcgacgctcgtcaatgccgcgtcggagccgcacgtgcaggagttctgccgg
ttcctcgcgatgctcggcgtgccgatcgagggcatcggcacatcgcacctgagcgttcag
ggcgggcgcgcgctcgcgggcggcgaataccgcttcaacgaggactttcacgaaatcgcg
acgtttctcgcgctcggcgcgatcacgggcggcgacatcgcggtgcgcaacggctcgccc
gagcagtttccgctgatcgatcggaccttcgcgaaattcggcgtgcaggtcacgcacgag
aacggctggtcgcacgcgctgcgcgacggcccgctgaaggtcaagcagccgttcacgcgc
aatatcctgacgaaagtcgaggccgcgccgtggccctacctgcccgtcgatctgctgccg
atcttcatcgcgctcggcgtgcaggcgcaaggcagcgtgatgttctggaacaaggtgtat
gacggcgcgatgggctggacgggcgagctgtcgaagttcggcgcgcacgtgttcctgtcc
gatccgcatcggctgatcacgttcggcgggctgccgctcagcccggcgcgcgtcgagagc
ccgtacatcatccgcgtcgcgatcgcgctgctgatggtcgccgcgagcatcgacggacgc
tcggagatcctgaacgcacagccgatccggcgcgcgcatccgcacttcgtcgagaacctg
cgctcggtcggcgcgaacgtcgagtggacgagcggcgaatga

DBGET integrated database retrieval system