KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A1590Help
Entry
BURPS1106A_A1590  CDS       T00480                                 

Definition
ACC deaminase/D-cysteine desulfhydrase family protein
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:bpl00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
II:complement(1545129..1546193)
Genome map
AA seq 354 aa AA seqDB search
MSRTRLLSELVPGLDTLVRPLDLLARPTPVTEEPELARRWGQAGLWIKRDDLANPLYGGS
KVRTLEFFLGRARAQRADGIVTMGPYGSHQLLATAVFGRRTGFLTRGVATPQPDVPEIAL
NRRLLPAYGMEVMRCASFAAVPAALLRARLKPLGAGRPFWIPPGANHPLGVMGVVEGALE
VAQAIRAGSLPVPDDVVVPTGTCATAAGVYLGFALAGLDVRVVAVRMVPMIVTGPAKLLR
MARQTERLLRRYGLTAPARWGELLWTNDHAGPSYGRAGLVAERARADVAQFGAFRTETTY
TAKTLALLAGGGLQRRRVLFWNTYSAIDPDPSRDAGGACAWPDGEPSVHSATAP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcacacgcctgctttccgaactggttcccgggctcgacacgctcgtcaggccg
ctcgatctgctcgcgcggcccacgccggtgaccgaggagccggagctcgcgcgtcgctgg
gggcaggccggcctgtggatcaagcgcgacgatctcgcgaatccgctctacggcggcagc
aaggtccgcacgctcgagttcttcctcggccgcgcgcgcgcgcaacgcgcggacggcatc
gtcacgatggggccctatggcagtcatcagttgctcgcgaccgcggtgttcggccggcgg
accggttttctcacgcgcggcgtcgcgacgccgcagcccgacgtgccggagatcgcgctg
aaccgccggctgctgcccgcgtacggaatggaggtgatgcgctgcgcgagcttcgccgcg
gtgcccgccgcgctgctgcgcgcgcggctcaagccgctcggcgccgggcggccgttctgg
attccgcccggcgcgaatcacccgctcggcgtgatgggcgtcgtcgagggcgcgctcgaa
gtcgcgcaggcgatccgcgcgggcagcctgccggttccggacgacgtcgtcgtgcccacc
ggcacctgcgcgacggcggcgggcgtctacctgggcttcgcgctcgccgggctcgacgtg
cgggtcgtcgcggtgcggatggtgccgatgatcgtcaccgggccggcgaagctgctgcgc
atggcccggcagaccgagcggctgctgcgccgctacggcctgacggcgcccgcgcgctgg
ggcgagctgctgtggaccaacgatcatgcggggccgagctatgggcgcgccggcctcgtc
gccgagcgcgcgcgcgccgacgtcgcgcaattcggcgcgttccgcaccgagaccacctac
accgcgaagacgctcgcgctgctcgcgggcggcggcctgcagcggcggcgggtgctgttc
tggaacacctacagcgcgatcgaccccgacccgtcgcgcgatgccggcggcgcatgcgcg
tggcccgacggcgagccctctgtccattccgcaaccgcaccgtag

DBGET integrated database retrieval system