KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A1673Help
Entry
BURPS1106A_A1673  CDS       T00480                                 

Definition
(GenBank) putative GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00790  Folate biosynthesis
bpl01100  Metabolic pathways
Module
bpl_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BURPS1106A_A1673
Enzymes [BR:bpl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BURPS1106A_A1673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: ABN95166
UniProt: A3P5U7
Position
II:complement(1642828..1643460)
Genome map
AA seq 210 aa AA seqDB search
MHQTGNERACGVHDQPHAEIRRVRRFDPIAFEAAVRALLEASGIEIDSAHTGRTAQRVRE
LWQRRLLDGYEVDPAQALGAGFDDPREDMVIVRSIAVHGVCPHHLLPFRGVAHVAYLPGG
RLHGFGRIARMIDAISHRYTYQEWITHRIATALVTHGQARGAACLIEAEQLCLLMGENRR
GDERVITQCYAGEFERDVQARNEFLRGIHR
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaaacgggaaacgagcgcgcgtgcggcgtgcacgatcaaccgcatgcggaaatc
cggcgcgtgcgccggttcgatcccatcgcattcgaggcggcggttcgcgctctgctcgag
gcgagcggcatcgagatcgacagcgcgcacaccggccgcactgcgcagcgtgtgcgcgag
ctctggcagcggcgtttgctcgacggctacgaagtcgatccggctcaggcgctgggcgcg
ggcttcgacgatccgcgcgaggacatggtgatcgtccgcagcatcgccgtgcacggcgtg
tgcccgcatcatttgctgccgtttcgcggcgtcgcccatgtggcgtatctgccgggcggg
cgcttgcacggcttcggacgcatcgcgcgcatgatcgacgcgatcagccatcgctatacg
tatcaggagtggatcacgcaccggatcgcgacggcgctcgtgacgcatggtcaggcgcgc
ggcgcggcgtgcctgatcgaggccgagcagctgtgcctgttgatgggcgagaaccggcga
ggcgacgagcgtgtgatcacgcagtgctacgccggcgaattcgagcgcgacgttcaggcc
cgcaacgagtttcttcgcggcatccaccgttag

DBGET integrated database retrieval system