KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A1724Help
Entry
BURPS1106A_A1724  CDS       T00480                                 

Definition
putative oxidoreductase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BURPS1106A_A1724
Enzymes [BR:bpl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BURPS1106A_A1724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
II:complement(1699442..1700740)
Genome map
AA seq 432 aa AA seqDB search
MHVLVVGAGIAGLAAAWQLKRGGCDVTVVEAAERAGGRIRSAPFHGHVIECGAQFPSSGY
RHLMPLFGEAGLDAQLVKTSPWAAFEHRGRLFRVHARRPWTIPASGLLGWRDSVRVSRAR
AALLARVRALDPNRYAAFAEFDDADAAHWAERAFGRAAVDAIFAPMIHGLYFQPLRGASR
ALLAAVTGFDGADTLAVAGGWQTLPVALAARLDVRYGTRVDALSAHANGVDACVGDRALR
FDAAIVATPATVARRLWRGQTDAQRALLATGYARCAHVAFGLAPGWRAPARLRRVYGALL
SPHARRVAALTFERGRGIGDGQGEVVSAMLGHAGASALRYASDDEIARVALDDLRTLLPG
VAEAVVATRVQRWDEAEPLSPVGRARAIAAYRASIDARPRVLLAGDYMGSPWTDGAAETG
RWAARRLLDARA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtactcgtcgtcggagcaggaatcgccgggctcgccgccgcctggcaattgaaa
cggggcggatgcgacgtgaccgtcgtcgaggccgccgaacgcgcgggcggccgcattcgc
agcgcgccgttccacggccatgtgatcgaatgcggcgcgcagtttccgtcctccggctat
cggcacttgatgccgctcttcggcgaggcggggctcgatgcgcaactcgtgaagacctcg
ccgtgggcggcgttcgagcatcgcgggcggctctttcgcgtgcatgcgcggcggccgtgg
acgatccccgcgagcggcctgctcggctggcgcgacagcgtgcgcgtgagccgggcgcgc
gccgcgctgctcgcgcgggttcgcgcgctcgatccgaaccgctatgcggcgttcgcggaa
ttcgacgacgccgacgcagcccactgggcggaacgcgcgttcgggcgcgcggcggtcgac
gcgatcttcgcgccgatgattcacgggctgtatttccagccgctgcgcggcgcgtcgcgc
gcgctgctcgcggccgtcaccggcttcgacggcgcggatacgctcgcggtcgcgggcggc
tggcagacgctgcccgtcgcgctcgcggcccggctcgacgtgcgctacggcacgcgggtc
gatgcgctgtcggcgcacgcgaacggcgtcgacgcgtgcgtcggcgatcgcgcgctgcgt
ttcgacgcggcgatcgtcgcgacgcccgcgaccgtcgcgcgccgcctctggcgcgggcag
accgacgcgcagcgcgcgctgctcgcgacgggctatgcacgctgcgcgcacgtcgcgttc
ggcctcgcgccgggctggcgcgcgcctgcgcggctgcgccgcgtgtacggcgcgctgctg
tcgccgcacgcgcgacgcgtcgcggcgctcacgttcgagcgcgggcgcgggatcggcgac
gggcagggcgaggtcgtatcggcgatgctcgggcatgcgggcgcgagcgcgctgcgctat
gcatcggacgacgagatcgcgcgcgtcgcgctcgacgacctgcgcacgctgttgccgggc
gtcgccgaggcggtcgtcgcgacgcgcgtgcagcgctgggacgaggccgagccgctgtcg
cccgtcggccgcgcgcgcgcgatcgccgcataccgcgcgagcatcgacgcgcgcccgcgc
gtgctgctcgcgggcgactacatgggctcgccgtggaccgacggcgcggcggagacgggc
agatgggcggcgcgcaggctgctcgacgcgcgcgcatga

DBGET integrated database retrieval system