KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A1821Help
Entry
BURPS1106A_A1821  CDS       T00480                                 

Definition
putative serine O-acetyltransferase
Orthology
K00640  
serine O-acetyltransferase [EC:2.3.1.30]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Cysteine biosynthesis, serine => cysteine
Class
Metabolism; Overview; Carbon metabolism [PATH:bpl01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:bpl01230]
Metabolism; Energy metabolism; Sulfur metabolism [PATH:bpl00920]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:bpl00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
II:complement(1788072..1789061)
Genome map
AA seq 329 aa AA seqDB search
MAVFDIDDIVQSLQTVRQRWREVQRRSLEPGGRELPAREALAGIVETFKGVLFPMRLGPP
DLRQESENFYVSHALDDALHALLAQARLELRYKGRHDAAAPAEAAIDAKADAAVRAFAAR
LPDIRALLDSDVLAAFHGDPAAGSVDEVLLCYPGVLAMIHHRLAHALYRLELPLLARIVA
EHAHAQTGIDIHPGAQIGGGFFIDHGTGVVIGETAVIGERVRVYQAVTLGAKRFPRDASG
HLEKGLARHPIVEDDVVVYAGATILGRVTIGKGAVIGGNVWITQDIPPGSHVTQAVTRSD
PARPADAAASSPRPAGAHDATLSAAQALR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtggcggtattcgacatcgacgacatcgttcaatcgcttcaaaccgtgcgccagcgttgg
cgcgaagtgcagcgccgctcgctcgagccgggcgggcgcgaattgccggcgcgcgaggcg
cttgccggcatcgtcgagacgttcaagggcgtgctgtttccgatgcgcctcgggccgccc
gatcttcggcaggagagtgaaaatttctatgtgagccacgcgctcgacgacgcattgcat
gcgcttctcgcgcaggctcggctcgaattgcgctacaagggccgacacgatgccgccgcg
cccgccgaagccgcgatcgacgcgaaagccgatgcggcggtgcgcgcgttcgccgcgcgc
ctgcccgatatccgcgcgctgctcgacagcgacgtgctggccgcgtttcacggcgatccg
gccgcgggcagcgtcgacgaggtgctgctttgctaccccggcgtgctggcgatgatccat
caccggctcgcgcacgcgctgtatcgcctcgaattgccgctgctcgcgcgcatcgtcgcc
gagcatgcgcatgcgcagacggggatcgacattcatcccggcgcgcagatcggcggcgga
ttcttcatcgatcacggcacgggcgtcgtgatcggcgagaccgcggtgatcggcgagcgc
gtgcgcgtctatcaggcggtcacgctcggcgcgaagcgctttccgagggacgcgtccggg
catctcgaaaagggactcgcgcgccacccgatcgtcgaggacgatgtcgtcgtctatgcg
ggcgcgacgattctcggccgcgtgacgatcggcaagggcgcggtgatcggcggcaacgtg
tggatcacgcaggacatcccgcccggcagccatgtcacgcaagccgtcacgcgcagcgat
ccggcgcggccggccgacgcggccgcctcgtcgccgcggccggccggcgcgcacgacgcg
acgctttctgccgcgcaggcgctgcgatga

DBGET integrated database retrieval system