KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A1821Help
Entry
BURPS1106A_A1821  CDS       T00480                                 

Definition
(RefSeq) putative serine O-acetyltransferase
  KO
K00640  
serine O-acetyltransferase [EC:2.3.1.30]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BURPS1106A_A1821
   01230 Biosynthesis of amino acids
    BURPS1106A_A1821
  Energy metabolism
   00920 Sulfur metabolism
    BURPS1106A_A1821
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BURPS1106A_A1821
Enzymes [BR:bpl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.30  serine O-acetyltransferase
     BURPS1106A_A1821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1788072..1789061)
Genome map
AA seq 329 aa AA seqDB search
MAVFDIDDIVQSLQTVRQRWREVQRRSLEPGGRELPAREALAGIVETFKGVLFPMRLGPP
DLRQESENFYVSHALDDALHALLAQARLELRYKGRHDAAAPAEAAIDAKADAAVRAFAAR
LPDIRALLDSDVLAAFHGDPAAGSVDEVLLCYPGVLAMIHHRLAHALYRLELPLLARIVA
EHAHAQTGIDIHPGAQIGGGFFIDHGTGVVIGETAVIGERVRVYQAVTLGAKRFPRDASG
HLEKGLARHPIVEDDVVVYAGATILGRVTIGKGAVIGGNVWITQDIPPGSHVTQAVTRSD
PARPADAAASSPRPAGAHDATLSAAQALR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtggcggtattcgacatcgacgacatcgttcaatcgcttcaaaccgtgcgccagcgttgg
cgcgaagtgcagcgccgctcgctcgagccgggcgggcgcgaattgccggcgcgcgaggcg
cttgccggcatcgtcgagacgttcaagggcgtgctgtttccgatgcgcctcgggccgccc
gatcttcggcaggagagtgaaaatttctatgtgagccacgcgctcgacgacgcattgcat
gcgcttctcgcgcaggctcggctcgaattgcgctacaagggccgacacgatgccgccgcg
cccgccgaagccgcgatcgacgcgaaagccgatgcggcggtgcgcgcgttcgccgcgcgc
ctgcccgatatccgcgcgctgctcgacagcgacgtgctggccgcgtttcacggcgatccg
gccgcgggcagcgtcgacgaggtgctgctttgctaccccggcgtgctggcgatgatccat
caccggctcgcgcacgcgctgtatcgcctcgaattgccgctgctcgcgcgcatcgtcgcc
gagcatgcgcatgcgcagacggggatcgacattcatcccggcgcgcagatcggcggcgga
ttcttcatcgatcacggcacgggcgtcgtgatcggcgagaccgcggtgatcggcgagcgc
gtgcgcgtctatcaggcggtcacgctcggcgcgaagcgctttccgagggacgcgtccggg
catctcgaaaagggactcgcgcgccacccgatcgtcgaggacgatgtcgtcgtctatgcg
ggcgcgacgattctcggccgcgtgacgatcggcaagggcgcggtgatcggcggcaacgtg
tggatcacgcaggacatcccgcccggcagccatgtcacgcaagccgtcacgcgcagcgat
ccggcgcggccggccgacgcggccgcctcgtcgccgcggccggccggcgcgcacgacgcg
acgctttctgccgcgcaggcgctgcgatga

DBGET integrated database retrieval system