KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A1821Help
Entry
BURPS1106A_A1821  CDS       T00480                                 

Definition
putative serine O-acetyltransferase
Orthology
K00640  
serine O-acetyltransferase [EC:2.3.1.30]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BURPS1106A_A1821
   01230 Biosynthesis of amino acids
    BURPS1106A_A1821
  Energy metabolism
   00920 Sulfur metabolism
    BURPS1106A_A1821
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BURPS1106A_A1821
Enzymes [BR:bpl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.30  serine O-acetyltransferase
     BURPS1106A_A1821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1788072..1789061)
Genome map
AA seq 329 aa AA seqDB search
MAVFDIDDIVQSLQTVRQRWREVQRRSLEPGGRELPAREALAGIVETFKGVLFPMRLGPP
DLRQESENFYVSHALDDALHALLAQARLELRYKGRHDAAAPAEAAIDAKADAAVRAFAAR
LPDIRALLDSDVLAAFHGDPAAGSVDEVLLCYPGVLAMIHHRLAHALYRLELPLLARIVA
EHAHAQTGIDIHPGAQIGGGFFIDHGTGVVIGETAVIGERVRVYQAVTLGAKRFPRDASG
HLEKGLARHPIVEDDVVVYAGATILGRVTIGKGAVIGGNVWITQDIPPGSHVTQAVTRSD
PARPADAAASSPRPAGAHDATLSAAQALR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtggcggtattcgacatcgacgacatcgttcaatcgcttcaaaccgtgcgccagcgttgg
cgcgaagtgcagcgccgctcgctcgagccgggcgggcgcgaattgccggcgcgcgaggcg
cttgccggcatcgtcgagacgttcaagggcgtgctgtttccgatgcgcctcgggccgccc
gatcttcggcaggagagtgaaaatttctatgtgagccacgcgctcgacgacgcattgcat
gcgcttctcgcgcaggctcggctcgaattgcgctacaagggccgacacgatgccgccgcg
cccgccgaagccgcgatcgacgcgaaagccgatgcggcggtgcgcgcgttcgccgcgcgc
ctgcccgatatccgcgcgctgctcgacagcgacgtgctggccgcgtttcacggcgatccg
gccgcgggcagcgtcgacgaggtgctgctttgctaccccggcgtgctggcgatgatccat
caccggctcgcgcacgcgctgtatcgcctcgaattgccgctgctcgcgcgcatcgtcgcc
gagcatgcgcatgcgcagacggggatcgacattcatcccggcgcgcagatcggcggcgga
ttcttcatcgatcacggcacgggcgtcgtgatcggcgagaccgcggtgatcggcgagcgc
gtgcgcgtctatcaggcggtcacgctcggcgcgaagcgctttccgagggacgcgtccggg
catctcgaaaagggactcgcgcgccacccgatcgtcgaggacgatgtcgtcgtctatgcg
ggcgcgacgattctcggccgcgtgacgatcggcaagggcgcggtgatcggcggcaacgtg
tggatcacgcaggacatcccgcccggcagccatgtcacgcaagccgtcacgcgcagcgat
ccggcgcggccggccgacgcggccgcctcgtcgccgcggccggccggcgcgcacgacgcg
acgctttctgccgcgcaggcgctgcgatga

DBGET integrated database retrieval system