KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A2050Help
Entry
BURPS1106A_A2050  CDS       T00480                                 

Definition
putative GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BURPS1106A_A2050
Enzymes [BR:bpl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BURPS1106A_A2050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
II:2019480..2019875
Genome map
AA seq 131 aa AA seqDB search
MGFDDRKEDMVIIRSIAVHGVCPHHLLPFRGVAHVAYLPGGRLHGFGRIARMIDAISHRF
TYQEWITNEIATALVTHGKARGAACLIEAEQLCLLMGENRRGDERVITQCYVGEFDHNAQ
ARNEFLRAINR
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
gtgggtttcgatgatcgaaaggaagatatggtcatcatccgcagtatcgctgtccatggt
gtttgtccgcatcacttgttgccatttcgcggcgtagcacacgtggcctatctgccggga
gggcgactgcatggcttcgggcgcatcgcccgtatgatcgatgcgatcagccatcgattt
acataccaagagtggattacaaacgagattgcgacagcccttgtcactcatggaaaagca
cggggagcagcttgcctgatcgaagccgaacaactgtgcttgctcatgggcgaaaatcgc
cgcggcgacgagcgcgtaattacgcaatgctacgtgggcgaatttgaccataacgcccag
gcgcgcaacgagtttcttcgcgccatcaatcgatag

DBGET integrated database retrieval system