KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A2145Help
Entry
BURPS1106A_A2145  CDS       T00480                                 

Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bpl00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
II:complement(2102657..2104219)
Genome map
AA seq 520 aa AA seqDB search
MARQAGRDEGVGRIGRIGRIGRIGRIGREAGDAREAAGAGEACGRRHARADAWARRASRA
SRGWRTFWRGGGRGRVRAVVASVVASFSVMAFAAATLPVSWRVAAAAERTRSGGERAGGL
RDTAGLIEISAAAPASTPIPAAPRRFAQPFAQPARAFAVASACAPSWPRWDRFKRDFVSA
DGRVIDVGSADERTVSEGQAYGLFFALVANDRAAFDALLRWTEDNLAQGDLSARLPAWLW
GRAADGAWRVLDANAASDADLWLAYALLEAGRLWRERSYTARGALLAKRVLDEETATLPG
LGLVLLPGPTGFRPARDAWRLNPSYSPPQAIRGIGAHVPDDARWARLAAGVGRVLTDSAP
RGFAPDWALYRAGRGFEPDAETHAASAYNAIRVYLWAGMLDAGDPLARPLVAHFAPFAEH
VAAHGAPPEAVDATTGAAAPRDGNAGFSAAAVPFLEARGERASADAQLARVARLERETAS
GYYANVLTLFGLGWRDGRYRFAADGTLRVRWSEPCSTPAR
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggcaagcggggcgagacgaaggcgtcgggcgcatcgggcgcatcgggcgcatc
gggcgcatcgggcgcatcgggcgtgaagcgggcgacgcgcgcgaggcggccggggcgggc
gaggcgtgcgggaggcgccacgcgcgggccgacgcgtgggcgcggcgggcgtcgcgagca
tcgcgcgggtggcgcacgttttggcgcgggggcgggcgtgggcgcgtgcgcgccgtcgtg
gcgagcgtcgtggcgagcttctcggtgatggcgttcgcggcggcgacgttgccggtgtcg
tggcgcgtcgccgcggcggcggagcgtacgcgaagcggcggcgaacgcgcgggcgggctg
cgcgacacggcgggcttgatcgagatctcggcggcggcgccggcctcgacgccgatcccg
gcggcgccgcggcggttcgcgcagccgttcgcgcagccggctcgcgcgttcgccgtcgcg
agcgcctgcgcgccgtcctggccgcgctgggaccgtttcaagcgtgacttcgtatcggcc
gacggccgcgtgatcgacgtcggctcggccgacgagcggaccgtatccgaggggcaggcg
tacggccttttcttcgcgctcgtcgcgaacgaccgcgcggcgttcgacgcgctgctgcgc
tggaccgaggacaatctcgcgcagggcgatctgagcgcgcgtctgcccgcgtggctgtgg
ggccgcgcggccgacggcgcgtggcgcgtgctcgatgcgaacgccgcgtccgacgccgat
ctgtggcttgcgtacgcgctgctcgaagcggggcgcttgtggcgcgagcgcagctacacg
gcgcgcggcgcgttgctcgcgaagcgcgtgctcgacgaggagaccgcgacgctgccgggg
ctcggtctcgtgctgctgccgggcccgacgggttttcggccggcgcgcgacgcgtggcgg
ctgaatccgagctattcgccgccgcaggcgattcgcgggatcggcgcgcatgtgcccgac
gacgcgcgctgggcgcggctcgcggcgggcgtcggccgcgtgctgaccgacagcgcgccg
cgcggcttcgcgccggactgggcgctgtatcgcgcgggccgcggcttcgagccggacgcc
gaaacgcatgcggcgagcgcgtacaacgcgattcgcgtctatctgtgggcgggcatgctc
gatgcgggcgacccgttggcgcggccgctcgtcgcgcatttcgcgccgttcgccgagcat
gtcgccgcgcatggcgcgccgccggaggcggtcgatgcgacgacgggcgcggccgccccg
cgcgacggcaatgccgggttttccgcggcggccgtgccgtttctcgaggcgcgcggcgag
cgggcgagcgccgacgcgcagctcgcgcgcgtcgcgcggctcgagcgcgagacggcgagc
ggctattacgcgaacgtgctgacgctgttcgggctcggctggcgcgacgggcgctaccgg
ttcgcggccgacggcacgctgcgggtgcgatggagcgagccgtgctcgacgcccgcgcgt
tga

DBGET integrated database retrieval system