KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A2157Help
Entry
BURPS1106A_A2157  CDS       T00480                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bpl00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
II:2111560..2112513
Genome map
AA seq 317 aa AA seqDB search
MSDDYFQPQSGNAMPRFAGIATMMRLPQAASAAGLDACFVGVPFDLGTSNRTGARFGPRQ
IRSESVLLRPYNMATRAAPFDSLRVADLGDVATNPYNLADSIARIEAAYHAILAHGCRPV
TLGGDHTITLPILRAMHRRHGRVGLIHVDAHADVNDTMFGEKIAHGTPFRRALEEGLLDG
DRVVQIGLRGTGYAAEDFDWCRDQGFRVVQAEACWNRSLAPLMDEVRARVQGGPVYLSFD
IDGIDPAYAPGTGTPEIAGLTVPQGLEIVRGAWGLDIVGADLVEVAPPYDPFGTTALLGA
NLAYEMLCVLPGVARRA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatgattacttccagccgcaaagcggcaacgcgatgccgcgcttcgccggcatc
gcgacgatgatgcggctgccgcaggcggcgagcgccgcggggctcgacgcgtgctttgtc
ggcgtgccgttcgatctcggcacgtcgaaccgcaccggcgcgcggttcggcccgcgccag
atccgcagcgaatccgtgctgctgcgcccgtacaacatggccacgcgcgcggcgccgttc
gattcgctgcgcgtcgccgatctcggcgacgtcgcgacgaacccgtacaacctcgccgat
tcgatcgcgcggatcgaggccgcgtaccacgcgatcctcgcgcacggctgccgcccggtc
acgctcggcggcgaccacacgatcacgctgccgatcctgcgcgcgatgcatcgccggcac
gggcgcgtcgggctcatccatgtcgacgcgcacgcggacgtcaacgacacgatgttcggc
gagaagatcgcgcacggcacgccgtttcgccgcgcgctcgaggaagggctgctcgacggc
gaccgcgtcgtgcagatcggcctgcgcggcaccggctatgcggccgaggatttcgactgg
tgccgcgatcagggctttcgcgtcgtccaggccgaggcgtgctggaaccgctcgctcgcg
ccgctgatggacgaagtgcgcgcgcgcgtgcaaggcggcccggtctatctgagcttcgac
atcgacggcatcgatccggcgtacgcgccgggcaccggcacgccggagatcgccggcctc
acggtgccgcagggcctcgagatcgtgcgcggcgcgtgggggctcgacatcgtcggcgcc
gatctcgtcgaggtcgcgccgccgtacgatccgttcggcaccaccgcgctgctcggcgcg
aacctcgcttacgagatgctctgcgtgctgcccggcgtggcgcggcgcgcgtga

DBGET integrated database retrieval system