KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A2307Help
Entry
BURPS1106A_A2307  CDS       T00480                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00260  Glycine, serine and threonine metabolism
bpl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bpl01100  Metabolic pathways
bpl01110  Biosynthesis of secondary metabolites
bpl01130  Biosynthesis of antibiotics
bpl01230  Biosynthesis of amino acids
Module
bpl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BURPS1106A_A2307 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BURPS1106A_A2307 (trpB)
Enzymes [BR:bpl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BURPS1106A_A2307 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABN95282
UniProt: A3P7N0
Position
II:complement(2285936..2287129)
Genome map
AA seq 397 aa AA seqDB search
MYNLPDDRGHFGPYGGVFVAETLIHALDELRAAYEKFKNDPDFVAEYNRELKHFVGRPSP
IYHAQRWSETLGGAQIYLKREDLNHTGAHKVNNVIGQALLAKRMGKRRVIAETGAGQHGV
ATATICARFGMECVVYMGAEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNIERTFYIIGTVAGPHPYPMMVRDFQRVIGDECKVQMPELAGRQPDAVIACVGGGSNA
MGIFYPYIDDAAVQLIGVEAAGDGLDTGHHAASLIAGSPGVLHGNRTYLLQDDDGQIIET
HSVSAGLDYPGVGPEHAWLKDSGRAQYVGITDEEALKAFHDCCRIEGIIPALESSHAIAY
GVKLAPTLPKDKILLVNLSGRGDKDMHTVAERSGITL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtataaccttcccgatgatcgcggccatttcggcccatatggcggcgtgtttgtcgcc
gaaacgctgattcacgcgctcgacgagctgcgtgccgcgtacgagaaattcaagaacgac
cccgacttcgtcgccgaatacaaccgtgagctgaagcacttcgtcggccgtccgtcgccg
atctatcacgcgcagcgctggagcgagacgctcggcggcgcgcagatctacctgaagcgc
gaggacctgaaccacacgggcgcgcacaaggtgaacaacgtgatcggccaggcgctgctc
gccaagcgcatgggcaagcggcgcgtgatcgccgagacgggcgcgggccagcacggcgtc
gccaccgcgacgatctgcgcgcgcttcggcatggagtgcgtcgtctacatgggcgccgag
gacgtgcgtcggcaggccgcgaacgtctaccggatgaagctgctcggcgcgaccgtcgtg
cccgtcgaatccggctcgcgcacgctgaaggatgcgttgaacgaggcgatgcgcgactgg
gtcacgaacatcgagcgcacgttctacatcatcggcacggtggcgggcccgcatccgtat
ccgatgatggtgcgcgacttccagcgcgtgatcggcgacgaatgcaaggtgcagatgccc
gagctcgccggccggcagcccgacgcggtgatcgcctgcgtcggcggcggctcgaacgcg
atgggcatcttctacccgtacatcgacgacgcggccgtccaattgatcggcgtcgaggcg
gcgggcgacgggctcgacaccggccatcacgcggcgtcgctgatcgccggcagcccgggc
gtgctgcacggcaaccgcacgtatctgctgcaggacgacgacggccagatcatcgagacg
cattcggtatcggccggcctcgactatccgggcgtcggccccgagcatgcctggctgaag
gacagcggccgcgcgcagtacgtcgggatcaccgacgaagaggcgctgaaggcgtttcac
gactgctgccggatcgaggggatcattcccgcgctcgaatcgagccacgcgatcgcctac
ggcgtgaagctcgcgccgacgctgccgaaggacaagatcctcctcgtcaacctgtcgggg
cgcggcgacaaggacatgcacacggtcgccgagcgatcgggcatcacgctctga

DBGET integrated database retrieval system