KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A2455Help
Entry
BURPS1106A_A2455  CDS       T00480                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BURPS1106A_A2455
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BURPS1106A_A2455
   00650 Butanoate metabolism
    BURPS1106A_A2455
  Amino acid metabolism
   00360 Phenylalanine metabolism
    BURPS1106A_A2455
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BURPS1106A_A2455
   00622 Xylene degradation
    BURPS1106A_A2455
   00621 Dioxin degradation
    BURPS1106A_A2455
Enzymes [BR:bpl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BURPS1106A_A2455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
II:complement(2421485..2422378)
Genome map
AA seq 297 aa AA seqDB search
MKSKSSRTRVAILGSGSIGLDLMFKVKASEQFDLKFVVGRNANSDGLRLARSCNVETSSD
GLDFLKAHEDAYDLVFDATSAAAHKVNNRFFSDAGKFVIDLTPAKVGRLCVPCINLDDMG
AEQNVNLITCGGQASLPLAYALKQAVDEIDYLEVVSAIASRSAGIATRENIDEYMTTTEY
ALAKFSGAKKTKAILNINPAEPGVRMQTTLYAYARYRDFDRVRASVADMVEKVREYVPGY
RLVVEPLESQGRITIGLTVRGRGDYLPEYAGNLDIINCAALAVASHRHATARLGATQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcaagtcatcgcgcacgcgggtggcgatcctgggttcgggcagcatcgggctc
gatctgatgttcaaagtcaaggcatccgagcaattcgatctgaagttcgtcgtcggacgc
aatgcgaacagcgacgggctgcggctcgcgcgcagttgcaacgtggagacatcgagcgac
ggtctcgatttcctgaaggcgcacgaggatgcgtacgacctcgtgttcgacgcgacatcg
gccgccgcgcacaaggtcaacaaccgcttcttctccgacgcgggcaagttcgtgatcgat
ctgacgcccgcgaaggtcggccgcctgtgcgtgccgtgcatcaatctggacgacatgggc
gccgagcagaacgtgaacctgatcacctgcggcgggcaggcgagcctgccgctcgcgtac
gcgctgaagcaggcggtcgacgagatcgattacctggaggtggtgtcggcgatcgcgtcg
cgcagcgccggcatcgcgacgcgcgagaacatcgacgaatacatgacgacgaccgagtac
gcgctcgcgaaattcagcggtgcgaagaagacgaaggcgatcctcaacatcaatccggcc
gagcccggtgtgcggatgcagacgacgctctatgcgtacgcgcgctatcgcgatttcgac
cgcgtgcgcgcaagcgttgccgacatggtcgagaaggtgcgcgaatacgtgcccggctat
cggctcgtcgtcgagccgctcgaaagccaggggaggatcacgatcggtctcaccgtgcgc
gggcgcggcgactatttgcccgagtacgcgggcaatctggacatcatcaactgcgcggcg
ctcgcggtcgcctcgcatcggcacgcaaccgccagactaggagccacacaatga

DBGET integrated database retrieval system