KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A2455Help
Entry
BURPS1106A_A2455  CDS       T00480                                 

Definition
(GenBank) putative acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00360  Phenylalanine metabolism
bpl00362  Benzoate degradation
bpl00620  Pyruvate metabolism
bpl00621  Dioxin degradation
bpl00622  Xylene degradation
bpl00650  Butanoate metabolism
bpl01100  Metabolic pathways
bpl01120  Microbial metabolism in diverse environments
bpl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BURPS1106A_A2455
   00650 Butanoate metabolism
    BURPS1106A_A2455
  Amino acid metabolism
   00360 Phenylalanine metabolism
    BURPS1106A_A2455
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BURPS1106A_A2455
   00622 Xylene degradation
    BURPS1106A_A2455
   00621 Dioxin degradation
    BURPS1106A_A2455
Enzymes [BR:bpl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BURPS1106A_A2455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh Glu_dehyd_C Shikimate_DH DapB_N
Motif
Other DBs
NCBI-ProteinID: ABN95095
UniProt: A3P826
Position
II:complement(2421485..2422378)
Genome map
AA seq 297 aa AA seqDB search
MKSKSSRTRVAILGSGSIGLDLMFKVKASEQFDLKFVVGRNANSDGLRLARSCNVETSSD
GLDFLKAHEDAYDLVFDATSAAAHKVNNRFFSDAGKFVIDLTPAKVGRLCVPCINLDDMG
AEQNVNLITCGGQASLPLAYALKQAVDEIDYLEVVSAIASRSAGIATRENIDEYMTTTEY
ALAKFSGAKKTKAILNINPAEPGVRMQTTLYAYARYRDFDRVRASVADMVEKVREYVPGY
RLVVEPLESQGRITIGLTVRGRGDYLPEYAGNLDIINCAALAVASHRHATARLGATQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcaagtcatcgcgcacgcgggtggcgatcctgggttcgggcagcatcgggctc
gatctgatgttcaaagtcaaggcatccgagcaattcgatctgaagttcgtcgtcggacgc
aatgcgaacagcgacgggctgcggctcgcgcgcagttgcaacgtggagacatcgagcgac
ggtctcgatttcctgaaggcgcacgaggatgcgtacgacctcgtgttcgacgcgacatcg
gccgccgcgcacaaggtcaacaaccgcttcttctccgacgcgggcaagttcgtgatcgat
ctgacgcccgcgaaggtcggccgcctgtgcgtgccgtgcatcaatctggacgacatgggc
gccgagcagaacgtgaacctgatcacctgcggcgggcaggcgagcctgccgctcgcgtac
gcgctgaagcaggcggtcgacgagatcgattacctggaggtggtgtcggcgatcgcgtcg
cgcagcgccggcatcgcgacgcgcgagaacatcgacgaatacatgacgacgaccgagtac
gcgctcgcgaaattcagcggtgcgaagaagacgaaggcgatcctcaacatcaatccggcc
gagcccggtgtgcggatgcagacgacgctctatgcgtacgcgcgctatcgcgatttcgac
cgcgtgcgcgcaagcgttgccgacatggtcgagaaggtgcgcgaatacgtgcccggctat
cggctcgtcgtcgagccgctcgaaagccaggggaggatcacgatcggtctcaccgtgcgc
gggcgcggcgactatttgcccgagtacgcgggcaatctggacatcatcaactgcgcggcg
ctcgcggtcgcctcgcatcggcacgcaaccgccagactaggagccacacaatga

DBGET integrated database retrieval system