KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A2605Help
Entry
BURPS1106A_A2605  CDS       T00480                                 

Definition
putative oxidoreductase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BURPS1106A_A2605
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BURPS1106A_A2605
  Lipid metabolism
   00071 Fatty acid degradation
    BURPS1106A_A2605
  Amino acid metabolism
   00350 Tyrosine metabolism
    BURPS1106A_A2605
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BURPS1106A_A2605
   00626 Naphthalene degradation
    BURPS1106A_A2605
Enzymes [BR:bpl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BURPS1106A_A2605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
II:complement(2552510..2553496)
Genome map
AA seq 328 aa AA seqDB search
MRAMVFDGGAPRLREAELPDPVPAAGQLLIDVHACGVCRTDLHVVDGDLRDPKRPVIPGH
EIVGTVAALGALAKGFTIGERVGVPWLGRTCGHCAYCASGRENLCDAPGFTGYTIDGGYA
QRTVADARFCVHVPSRYDDIHAAPLLCAGLIGYRTLKMAGSARRIGLYGFGAAAHLVAQV
ARFQGRTVYAFTRPGDAAAQRLARRLGAAWAGGSDEAAPEPLDAALIFASVGALVPAALA
AVVKGGAVVCGGIHMSDIPSFSYDLLWGERRIVSVANLTRDDAAEFMRIANDVPLDVEAT
PYPLAQANQALDDLRAGRLAGAAVLTMR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgatggtattcgacggcggcgcgccgcggctgcgcgaagccgagctgccggac
cccgtgccggcggcggggcaactgctgatcgacgtgcacgcgtgcggcgtgtgccggacc
gatctgcacgtcgtcgacggcgatctgcgcgatccgaagcggccggtgattccggggcac
gagatcgtcggcacggtggccgcgctcggcgcgctcgcgaagggtttcacgatcggcgag
cgtgtcggcgtgccttggctcgggcgcacgtgcggccattgcgcgtactgcgcgagcggc
cgcgagaacctgtgcgatgcgcccggcttcaccggctacacgatcgacggcggctatgcg
cagcgcacggtcgccgacgcgcgcttttgcgtgcacgtgccgagccgctacgacgatatt
catgcggcgccgctgctgtgcgcgggtctcatcggctaccggacgctgaagatggccggt
tccgcgcggcgcatcggcctgtacggattcggcgcggccgcgcacctcgtcgcgcaggtc
gcgcgttttcaggggcgcaccgtttatgcgttcacgcgcccgggcgacgccgccgcacag
cggctcgcgcgccggctcggcgccgcgtgggcgggcggcagcgacgaagccgcgcccgag
ccgctcgatgcggcgctgatcttcgcatcggtcggcgcgctcgtgccggccgcgctcgcg
gcggtcgtgaagggcggcgccgtcgtgtgcggtgggattcacatgtcggacattccgtcg
ttttcgtacgatttgttgtggggcgagcggcggatcgtatcggtcgcgaacctgacgcgc
gacgacgcggccgaattcatgcggattgcgaacgacgtgccgctcgacgtggaggcaacg
ccgtatccgctcgcgcaggcgaaccaggcgctcgacgatctgcgcgccggacgtctggcc
ggggcggcggtgttgacgatgcgctag

DBGET integrated database retrieval system