KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A2659Help
Entry
BURPS1106A_A2659  CDS       T00480                                 

Definition
(GenBank) putative fructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00010  Glycolysis / Gluconeogenesis
bpl00030  Pentose phosphate pathway
bpl00051  Fructose and mannose metabolism
bpl00052  Galactose metabolism
bpl00680  Methane metabolism
bpl01100  Metabolic pathways
bpl01110  Biosynthesis of secondary metabolites
bpl01120  Microbial metabolism in diverse environments
bpl01130  Biosynthesis of antibiotics
bpl01200  Carbon metabolism
bpl01230  Biosynthesis of amino acids
Module
bpl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BURPS1106A_A2659
   00030 Pentose phosphate pathway
    BURPS1106A_A2659
   00051 Fructose and mannose metabolism
    BURPS1106A_A2659
   00052 Galactose metabolism
    BURPS1106A_A2659
  Energy metabolism
   00680 Methane metabolism
    BURPS1106A_A2659
Enzymes [BR:bpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BURPS1106A_A2659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: ABN95297
UniProt: A3P8M9
Position
II:complement(2598307..2599635)
Genome map
AA seq 442 aa AA seqDB search
MRGACASRAMFDTGGKRQAASGKRQAASGKRQAASGKRQAASGKRQAASGKQQAASSKQQ
AASSKQQAASSKQQAASSSRSSPGLMVRRRIERKHCGACPPRSTREPRTRASRCVVFPSR
IPTLKPNVTMPEIVTLTPNPAIDVATCVERVTDTRKLRCGPARRDPGGGGINVARVLTRL
GADCSAVYLAGGGTGLALRGLLADEGVRAHGIDIAGETRENFSVLETSTGREFRFVLPGP
ALAAHEWPRCVEALGRLADASRYLVMSGSLPPGMPDDCYARLARRASARGVRTVVDTSGP
ALAAALDAGVYLVKPSLGELRALTGLPLEDDGARLAAARAIVAGGRAQIVALTLGDAGAL
VVSRDDAVRLPGVKVAVRSAIGAGDSFVAGLVAALNRGANVADAARHALAAASASLLSTG
TALGTKEDIARIYRELPGMIDA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcggcgcttgcgcgtcgcgcgcgatgttcgatactggcggcaagcggcaagcggca
agcggcaagcggcaagcggcaagcggcaagcggcaagcggcaagcggcaagcggcaagcg
gcaagcggcaagcggcaagcggcaagcggcaagcagcaagcagcaagcagcaagcagcaa
gcagcaagcagcaagcagcaagcagcaagcagcaagcagcaagcagcaagcagcagtcga
tcgtcgccggggctgatggttcgacgccgaatcgaacgcaagcattgcggcgcgtgcccg
ccgcgcagcacccgcgagccgcgcacccgagccagccgctgcgttgtctttccgtcgcga
attcccacgttgaaaccgaacgtcacgatgcccgaaatcgtcaccctcacgccgaatccc
gccatcgacgtcgcgacgtgcgtcgagcgagtcaccgacacccgcaagctgcgctgcggc
cccgcacgacgcgatccgggcggcggcggaatcaatgtcgcccgcgtgctgacgcgcctc
ggcgccgattgttcggccgtctacctggcgggcggcggcaccggcctcgcgctgcgcggc
ctgctcgccgacgaaggcgtgcgggcgcatggcatcgacatcgccggcgagacgcgcgaa
aacttttcggtgctcgaaacgtcgacgggccgcgaattccgcttcgtgttgcccgggccg
gcgctcgcggcgcacgaatggccgcgctgcgtcgaagcgctcgggcggctcgccgacgcg
tcgcgctatctggtgatgagcggcagcctgccgcccggcatgccggacgattgctacgcc
cggctcgcgcggcgcgcgagcgcgcgcggcgtgcgcacggtcgtcgatacgtcgggaccg
gcgctcgccgccgcgctcgatgcgggcgtctatctggtgaagccgagcctcggcgagttg
cgcgcgctgaccggcctgccgctcgaagacgacggcgcgcgccttgccgccgcgcgcgcg
atcgtcgccggcgggcgcgcgcagatcgtcgcgctgacgctcggcgacgcgggcgcgctc
gtcgtgtcgcgcgacgatgcggtgcgtctgccgggcgtgaaggtggcggtgcgcagcgcg
atcggcgcgggcgacagcttcgtcgcggggctcgtcgccgcgctcaatcgcggcgcgaac
gtcgccgacgcggcgcgccatgcgctcgccgccgcgtcggcgtcgctgctgagcacgggc
accgcgctgggcacgaaggaagacatcgcgcggatctatcgcgaactgccgggaatgatc
gacgcgtga

DBGET integrated database retrieval system