KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A2659Help
Entry
BURPS1106A_A2659  CDS       T00480                                 

Definition
putative fructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BURPS1106A_A2659
   01230 Biosynthesis of amino acids
    BURPS1106A_A2659
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BURPS1106A_A2659
   00030 Pentose phosphate pathway
    BURPS1106A_A2659
   00051 Fructose and mannose metabolism
    BURPS1106A_A2659
   00052 Galactose metabolism
    BURPS1106A_A2659
  Energy metabolism
   00680 Methane metabolism
    BURPS1106A_A2659
Enzymes [BR:bpl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BURPS1106A_A2659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
II:complement(2598307..2599635)
Genome map
AA seq 442 aa AA seqDB search
MRGACASRAMFDTGGKRQAASGKRQAASGKRQAASGKRQAASGKRQAASGKQQAASSKQQ
AASSKQQAASSKQQAASSSRSSPGLMVRRRIERKHCGACPPRSTREPRTRASRCVVFPSR
IPTLKPNVTMPEIVTLTPNPAIDVATCVERVTDTRKLRCGPARRDPGGGGINVARVLTRL
GADCSAVYLAGGGTGLALRGLLADEGVRAHGIDIAGETRENFSVLETSTGREFRFVLPGP
ALAAHEWPRCVEALGRLADASRYLVMSGSLPPGMPDDCYARLARRASARGVRTVVDTSGP
ALAAALDAGVYLVKPSLGELRALTGLPLEDDGARLAAARAIVAGGRAQIVALTLGDAGAL
VVSRDDAVRLPGVKVAVRSAIGAGDSFVAGLVAALNRGANVADAARHALAAASASLLSTG
TALGTKEDIARIYRELPGMIDA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcggcgcttgcgcgtcgcgcgcgatgttcgatactggcggcaagcggcaagcggca
agcggcaagcggcaagcggcaagcggcaagcggcaagcggcaagcggcaagcggcaagcg
gcaagcggcaagcggcaagcggcaagcggcaagcagcaagcagcaagcagcaagcagcaa
gcagcaagcagcaagcagcaagcagcaagcagcaagcagcaagcagcaagcagcagtcga
tcgtcgccggggctgatggttcgacgccgaatcgaacgcaagcattgcggcgcgtgcccg
ccgcgcagcacccgcgagccgcgcacccgagccagccgctgcgttgtctttccgtcgcga
attcccacgttgaaaccgaacgtcacgatgcccgaaatcgtcaccctcacgccgaatccc
gccatcgacgtcgcgacgtgcgtcgagcgagtcaccgacacccgcaagctgcgctgcggc
cccgcacgacgcgatccgggcggcggcggaatcaatgtcgcccgcgtgctgacgcgcctc
ggcgccgattgttcggccgtctacctggcgggcggcggcaccggcctcgcgctgcgcggc
ctgctcgccgacgaaggcgtgcgggcgcatggcatcgacatcgccggcgagacgcgcgaa
aacttttcggtgctcgaaacgtcgacgggccgcgaattccgcttcgtgttgcccgggccg
gcgctcgcggcgcacgaatggccgcgctgcgtcgaagcgctcgggcggctcgccgacgcg
tcgcgctatctggtgatgagcggcagcctgccgcccggcatgccggacgattgctacgcc
cggctcgcgcggcgcgcgagcgcgcgcggcgtgcgcacggtcgtcgatacgtcgggaccg
gcgctcgccgccgcgctcgatgcgggcgtctatctggtgaagccgagcctcggcgagttg
cgcgcgctgaccggcctgccgctcgaagacgacggcgcgcgccttgccgccgcgcgcgcg
atcgtcgccggcgggcgcgcgcagatcgtcgcgctgacgctcggcgacgcgggcgcgctc
gtcgtgtcgcgcgacgatgcggtgcgtctgccgggcgtgaaggtggcggtgcgcagcgcg
atcggcgcgggcgacagcttcgtcgcggggctcgtcgccgcgctcaatcgcggcgcgaac
gtcgccgacgcggcgcgccatgcgctcgccgccgcgtcggcgtcgctgctgagcacgggc
accgcgctgggcacgaaggaagacatcgcgcggatctatcgcgaactgccgggaatgatc
gacgcgtga

DBGET integrated database retrieval system