KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A2662Help
Entry
BURPS1106A_A2662  CDS       T00480                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BURPS1106A_A2662 (deoA)
Enzymes [BR:bpl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     BURPS1106A_A2662 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
II:complement(2601559..2602881)
Genome map
AA seq 440 aa AA seqDB search
MTFLPQEFIRKVRDRAPLDTADVARFVQGVTAGDVTEGQIAAFAMAVYFNELPLSARIAL
TLAQRDSGDVLDWRGARLNGPVVDKHSTGGVGDLTSLVIGPMVAACGGYVPMISGRGLGH
TGGTLDKLEAIPGYDVAPSVDMLRRVVRDAGLAIVGQTAQLAPADKRIYAVRDVTATVES
ISLITASILSKKLAAGVSALAMDVKVGSGAFMPSAEQSAELARSIVDVGNGAGMRTAATL
TDMNQALAPCAGNAIEVRCAIDFLTGAARPARLEAVSFALAAQMLTMGGLAADAHDARRR
LRAVLESGAAAERFARMVAALGGPADLVERPERHLPRAAAAAPVAAARAGWIERIDARAL
GLAVVGLGGGRAKIGDTLDYSVGLSALAELGERVEAGQPLATVHARDADSAAQATDAVRR
AYRIGAEPPAQTRVVHAVIE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcctgccgcaggaattcatccgcaaggtgcgcgaccgcgcgccgctcgacacg
gccgacgtcgcgcgtttcgtccaaggcgtgacggcgggcgacgtgaccgaaggccagatc
gccgcgttcgcgatggcggtctatttcaacgagttgccgctgtccgcgcgcatcgcgctg
acgctcgcgcagcgcgattccggcgacgtgctcgactggcgcggcgcgcgcctgaacggg
ccggtggtcgacaagcactcgacgggcggcgtcggcgatctgacctcgctcgtgatcggg
ccgatggtggccgcgtgcggcggctacgtgccgatgatctcgggccgcggcctcggccac
acgggcggcacgctcgacaagctcgaggcgattcccggttacgatgtcgcgccgtccgtc
gacatgctgcgccgcgtcgtgcgcgacgcgggccttgcgatcgtcggccagaccgcgcag
ctcgcgcccgccgacaagcggatctatgcggtgcgcgacgtgacggcgaccgtcgaatcg
atctcgctgatcaccgcgtcgatcctgtcgaagaagctcgcggcgggcgtcagcgcgctc
gcgatggacgtgaaggtcggctccggcgcgttcatgccgagcgcggagcaatcggccgaa
ctcgcgcgcagcatcgtcgacgtcggcaacggcgcggggatgaggacggccgcgacgctc
accgacatgaaccaggcgctcgcgccatgcgcgggcaacgcgatcgaggtgcgctgcgcg
atcgatttcctgacgggcgcggcgcgccccgcgcggctcgaagcggtcagcttcgcgctc
gccgcgcagatgctgacgatgggcgggcttgccgcggacgcgcacgatgcgcgccgccgg
ttgcgcgcggtgctcgaatcgggcgcggccgcggagcggttcgcgcggatggtcgcggcg
ctcggcgggcccgccgatctggtcgagcggcccgagcggcatctgccgcgcgcggctgcc
gccgcccccgtggccgccgcgcgcgccggctggatcgagcggatcgacgcgcgcgcgctc
ggcctggcggtcgtcggcctgggcggcgggcgcgcgaagatcggcgacacgctcgattac
tcggtcggactgtccgcgctcgcggagctgggcgagcgcgtcgaggcgggccagccgctc
gcgaccgttcacgcgcgcgacgccgattcggccgcgcaggcgaccgacgcggtgcggcgc
gcctaccggatcggcgcggagccgccggcgcagacgcgcgtcgttcatgccgtgatcgaa
tga

DBGET integrated database retrieval system