KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A2740Help
Entry
BURPS1106A_A2740  CDS       T00480                                 

Gene name
glmS
Definition
(GenBank) glutamine-fructose-6-phosphate transaminase (isomerizing)
  KO
K00820  glucosamine---fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
bpl00250  Alanine, aspartate and glutamate metabolism
bpl00520  Amino sugar and nucleotide sugar metabolism
bpl01100  Metabolic pathways
bpl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BURPS1106A_A2740 (glmS)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BURPS1106A_A2740 (glmS)
Enzymes [BR:bpl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     BURPS1106A_A2740 (glmS)
Peptidases [BR:bpl01002]
 Cysteine Peptidases
  Family C44
   BURPS1106A_A2740 (glmS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIS GATase_6 GATase_7 GATase_4 SIS_2
Motif
Other DBs
NCBI-ProteinID: ABN94545
UniProt: A3P8W0
Position
II:complement(2673688..2675511)
Genome map
AA seq 607 aa AA seqDB search
MCGIVGAVAQRNIVPILIEGLRRLEYRGYDSCGVATVVDGEARRERSVSRVADLEAHVRT
AGLAGTTGIAHTRWATHGAPATCNAHPIFSRDHIALVHNGIIENHEALRTQLAGEHYEFD
GQTDTEVVAHLIHSKYRGDLLAAVRDATAQLRGAYAIAVFSKTEPNRLIGARVGSPLVVG
LKDGECFLASDALALALAGITDQFIFLDEGDIVELTPRGARIVDRDGRPVVRAVQTVSAA
QGAAELGEYRHFMQKEIFEQPRAVAATIPDAGLFDPAVFGHDARRAFEQIDNVLILACGT
SHYAGLTARRWLETVARIPAQVEIASEYRYSDAVAMPNTLIVVISQSGETADTLAALKYA
QALGHIDTLAICNVPTSAMMRQAGLRFLTRAGPEIGVASTKAFTTQLVALFVLAVTLGRM
RGYVDDAQLARCTQQLRRLPGALEDVLALEPRVKRWADEFACHENALFLGRGLHYPIALE
GALKLKEISYIHAEAYPAGELKHGPLALVTNTMPVATIAPNDALLEKLKSNMQEVRARGG
QLYVFADADTRIDDGDGISVMRMPDYYGLLSPILHVVPLQLLAYHAACNRGTDIDKPRNL
AKSVTVE
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggatcgtcggcgcggtagcgcaacggaacatcgttccgattctgatcgaaggc
ttacgccgcctcgaatatcgcggctacgattcgtgcggcgtggcgaccgtggtggacggc
gaggcgcggcgcgagcgcagcgtctcgcgcgtcgccgatctcgaggcgcacgtgcgtacg
gcgggcctcgccggcaccacgggcatcgcgcacacgcgctgggcgacgcatggcgcgccc
gccacgtgcaacgcgcacccgatcttctcgcgcgatcacatcgcactcgttcacaacggc
atcatcgagaatcacgaagcgctgcgcacgcagctcgccggcgagcattacgaattcgac
gggcagaccgataccgaagtcgtcgcgcatctgattcacagcaagtaccgcggcgatctg
ctggcggccgttcgcgatgcgacggcgcagttgcgcggcgcgtatgcgatcgcggtgttc
agcaagaccgagccgaaccggctgatcggcgcgcgggtcggctcgccgctcgtcgtcggc
ctgaaggacggcgagtgcttcctggcgtcggacgcgctcgcgctcgcgctcgcgggcatt
accgatcagttcatctttctcgacgaaggcgacatcgtcgagctgacgccgcgcggcgcg
cggatcgtcgatcgcgacggcaggccggtcgtgcgcgcggtgcagacggtatcggcggcg
cagggcgcggcggagctcggcgaataccggcatttcatgcagaaggagatcttcgagcag
ccgcgcgcggtggcggcgacgatccccgacgcggggctgttcgatccggcggtgttcggc
cacgacgcgcggcgcgcgttcgagcagatcgacaacgtgctgatcctcgcgtgcgggacg
agccattacgcggggctgaccgcgcgccgctggctcgagacggtcgcgcggattcccgcg
caggtcgagatcgcgagcgaataccggtacagcgacgcggtggcgatgccgaacacgctg
atcgtcgtgatatcgcaatcgggcgagacggccgacacgctcgccgcgctgaagtatgcg
caggcgctcggccatatcgatacgctcgcgatctgcaacgtgccgacgagcgcgatgatg
cggcaggccgggctgcgcttcctgacgcgcgcgggcccggaaatcggcgtcgcgtcgacg
aaggcgtttacgacgcaactcgtcgcgctgttcgtgctggcggtcacgctcgggcggatg
cgcggctacgtggacgacgcgcagctcgcgcgctgcacgcagcagttgcgccggctgccc
ggcgcgctcgaggacgtgctcgcgctcgagccgcgggtgaagcgttgggcggacgagttc
gcgtgccacgagaacgcgctgttcctcgggcgcgggctgcactatccgatcgcgctcgaa
ggcgcgctgaagctcaaggagatctcgtacattcacgcggaagcgtatccggcgggcgag
ctgaagcacggcccgctcgcgctcgtgacgaatacgatgccggtcgcgacgatcgcgccg
aacgacgcgttgctcgagaagctgaagtcgaacatgcaggaagtgcgcgcgcgcggcggg
cagctctatgtgttcgccgatgcggacacgcggatcgacgacggcgacgggatatcggtg
atgaggatgccggattattacgggctgctgtcgccgattctgcatgtcgtgccgctgcaa
ctgctcgcgtatcacgcggcgtgcaacagggggacggatatcgacaagccgaggaacctg
gcgaagtcggtgacggtggagtag

DBGET integrated database retrieval system