KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A2777Help
Entry
BURPS1106A_A2777  CDS       T00480                                 

Definition
carbamoyl-phosphate synthase L chain/biotin carboxylase
Orthology
K13777  
geranyl-CoA carboxylase alpha subunit [EC:6.4.1.5]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Geraniol degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    BURPS1106A_A2777
Enzymes [BR:bpl01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.5  geranoyl-CoA carboxylase
     BURPS1106A_A2777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:2708419..2710425
Genome map
AA seq 668 aa AA seqDB search
MSTRRFTRLLIANRGEIAVRIARTARRLGIATIAVHSDADARSPHVAACDDAVAIGGATP
AESYLSIDKLIDAALTSGAQAIHPGYGFLSEHAAFARRAAEAGLVFVGPRADAIDAMGDK
ARARRRMAAAGIAVVPGYDGDDQREARLLSEAERIGFPVMLKAAAGGGGRGMRRVDARDA
LPGALKRAVSESQQAFGDGRMIVERAVIEPRHIEVQVFADAHGRIVHLGERDCSVQRRHQ
KIVEEAPSPAVDAALRERLGATAVAVAREIGYVGAGTVEFLLDREGRFYFMEMNTRLQVE
HPVTELITGQDLVEWQLRVAQGDALPLAQQDIRLDGHAIEVRLCAEDPADDFLPRTGSVL
TWRPGRHARCDHALADGLAISPFYDSMLGKLIAHGGSRAEAIDRLAHALDDTVLLGVPTN
RAFLARVLRHPVFADGRAVSTAFVAAHFPDNDSRRCAPTQAVWAIAAWLSTLAADRADAL
PGAWRGWRNGAPLPVPYRLSLANAGADHPDARRGIVTAERQRAVVHAQGGSPIVLDAARP
PCPGEPSTVSIDGRAHACCFAIAHGRLWLQVDGVDHAFAIHNREGRASAAAADSDGVLRA
PMNGRVIAVDIDEGATVSAGQTVMVLEAMKMEHAITAPFAGRIASLGARPGEQVSPGQVL
ARLEPQAG
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcgccgcttcacccggcttctgatcgccaaccgcggcgagatcgcggtgcgc
atcgcgcgcaccgcgcggcggctcggcatcgcgacgatcgccgttcattccgacgcggat
gcgcgcagcccgcacgtcgccgcctgcgatgacgcggtggcgatcggcggcgcgacgccc
gccgaatcgtacctgtcgatcgacaagctgatcgacgccgcattgacgagcggcgcgcag
gccattcatcccggctacggcttcctgtccgagcatgcggcgttcgcgcggcgtgcggcc
gaagcgggcctcgtgttcgtcggcccgcgcgccgacgcgatcgacgcgatgggcgacaag
gcgcgcgcgcgccgccggatggccgcggccggcatcgccgtcgtgcccggctacgacggc
gacgaccagcgcgaagcgcgccttctttcggaagccgaacgaatcggctttcccgtgatg
ctgaaggcggcggcgggcggcggcgggcgcggaatgcgccgcgtcgacgcgcgcgacgcg
ctgcccggcgcgctgaagcgcgcggtgtccgagtcgcaacaggcgttcggcgacggccgg
atgatcgtcgagcgcgcggtgatcgagccgcgccacatcgaggtgcaggtgttcgccgat
gcgcacggccggatcgttcacctcggcgagcgcgattgctcggtgcagcgccgtcaccag
aagatcgtcgaggaagcgccgtcgcccgccgtcgacgccgcgctgcgcgagcggctcggc
gcgacggccgtggccgtcgcgcgcgagatcggctacgtcggcgcgggcaccgtcgaattc
ctgctcgatcgcgaaggccggttctatttcatggaaatgaacacgcggctgcaagtcgag
catccggtgaccgagctgatcaccgggcaggacctggtcgaatggcaattgcgcgtcgcg
cagggcgacgcgttgccgctcgcacagcaggacatccggctcgacgggcacgcgatcgag
gttcgcctctgcgcggaagaccccgccgacgacttcctgccgcgcacgggcagcgtgctg
acatggcggccgggccgccatgcgcgctgcgatcacgcgctcgccgacggcctcgcgatc
agcccgttctacgattcgatgctcggcaagctgatcgcgcacggcggctcgcgcgcggag
gcgatcgaccggctcgcgcacgcgctcgacgacacggtgctgctcggcgtgccgaccaat
cgcgcgtttctcgcgcgcgtgctgcgccatcccgtattcgccgacgggcgcgcggtatcc
accgcgttcgtcgcggcgcacttccccgacaacgacagccgccgctgcgcgccgacgcaa
gccgtgtgggcgatcgccgcatggctgtcgacgctcgccgccgatcgcgccgacgcgctg
cccggcgcgtggcgcggctggcgcaacggcgcgccgctgccggtgccgtatcggctgtcc
ctcgcgaacgccggcgcggatcatccggacgcgcggcgcggcatcgtgacggccgagcgg
cagcgcgcggtcgtgcacgcgcaaggcggctcgccgatcgtgctcgacgcggcccgcccc
ccatgcccgggcgagccctcgacggtatcgatcgacggccgcgcgcatgcgtgctgcttc
gcgatcgcgcacggccggctgtggctgcaagtcgacggcgtcgatcacgcgttcgcgatc
cacaaccgcgaaggccgcgcgagcgccgcggcggccgacagcgacggcgtgctgcgcgcg
ccgatgaacggccgcgtgatcgcggtcgacatcgatgaaggcgcgaccgtatcggccggg
caaaccgtcatggtgctcgaggcgatgaagatggaacacgcaatcaccgcgccgttcgcg
ggccgaatcgcgtcgctcggcgcacgcccgggcgagcaggtctcacccggccaggtgctc
gcgcggctcgagccgcaggccggctga

DBGET integrated database retrieval system