KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A2777Help
Entry
BURPS1106A_A2777  CDS       T00480                                 

Definition
carbamoyl-phosphate synthase L chain/biotin carboxylase
Orthology
K13777  
geranyl-CoA carboxylase alpha subunit [EC:6.4.1.5]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Geraniol degradation
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Geraniol degradation [PATH:bpl00281]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
II:2708419..2710425
Genome map
AA seq 668 aa AA seqDB search
MSTRRFTRLLIANRGEIAVRIARTARRLGIATIAVHSDADARSPHVAACDDAVAIGGATP
AESYLSIDKLIDAALTSGAQAIHPGYGFLSEHAAFARRAAEAGLVFVGPRADAIDAMGDK
ARARRRMAAAGIAVVPGYDGDDQREARLLSEAERIGFPVMLKAAAGGGGRGMRRVDARDA
LPGALKRAVSESQQAFGDGRMIVERAVIEPRHIEVQVFADAHGRIVHLGERDCSVQRRHQ
KIVEEAPSPAVDAALRERLGATAVAVAREIGYVGAGTVEFLLDREGRFYFMEMNTRLQVE
HPVTELITGQDLVEWQLRVAQGDALPLAQQDIRLDGHAIEVRLCAEDPADDFLPRTGSVL
TWRPGRHARCDHALADGLAISPFYDSMLGKLIAHGGSRAEAIDRLAHALDDTVLLGVPTN
RAFLARVLRHPVFADGRAVSTAFVAAHFPDNDSRRCAPTQAVWAIAAWLSTLAADRADAL
PGAWRGWRNGAPLPVPYRLSLANAGADHPDARRGIVTAERQRAVVHAQGGSPIVLDAARP
PCPGEPSTVSIDGRAHACCFAIAHGRLWLQVDGVDHAFAIHNREGRASAAAADSDGVLRA
PMNGRVIAVDIDEGATVSAGQTVMVLEAMKMEHAITAPFAGRIASLGARPGEQVSPGQVL
ARLEPQAG
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcgccgcttcacccggcttctgatcgccaaccgcggcgagatcgcggtgcgc
atcgcgcgcaccgcgcggcggctcggcatcgcgacgatcgccgttcattccgacgcggat
gcgcgcagcccgcacgtcgccgcctgcgatgacgcggtggcgatcggcggcgcgacgccc
gccgaatcgtacctgtcgatcgacaagctgatcgacgccgcattgacgagcggcgcgcag
gccattcatcccggctacggcttcctgtccgagcatgcggcgttcgcgcggcgtgcggcc
gaagcgggcctcgtgttcgtcggcccgcgcgccgacgcgatcgacgcgatgggcgacaag
gcgcgcgcgcgccgccggatggccgcggccggcatcgccgtcgtgcccggctacgacggc
gacgaccagcgcgaagcgcgccttctttcggaagccgaacgaatcggctttcccgtgatg
ctgaaggcggcggcgggcggcggcgggcgcggaatgcgccgcgtcgacgcgcgcgacgcg
ctgcccggcgcgctgaagcgcgcggtgtccgagtcgcaacaggcgttcggcgacggccgg
atgatcgtcgagcgcgcggtgatcgagccgcgccacatcgaggtgcaggtgttcgccgat
gcgcacggccggatcgttcacctcggcgagcgcgattgctcggtgcagcgccgtcaccag
aagatcgtcgaggaagcgccgtcgcccgccgtcgacgccgcgctgcgcgagcggctcggc
gcgacggccgtggccgtcgcgcgcgagatcggctacgtcggcgcgggcaccgtcgaattc
ctgctcgatcgcgaaggccggttctatttcatggaaatgaacacgcggctgcaagtcgag
catccggtgaccgagctgatcaccgggcaggacctggtcgaatggcaattgcgcgtcgcg
cagggcgacgcgttgccgctcgcacagcaggacatccggctcgacgggcacgcgatcgag
gttcgcctctgcgcggaagaccccgccgacgacttcctgccgcgcacgggcagcgtgctg
acatggcggccgggccgccatgcgcgctgcgatcacgcgctcgccgacggcctcgcgatc
agcccgttctacgattcgatgctcggcaagctgatcgcgcacggcggctcgcgcgcggag
gcgatcgaccggctcgcgcacgcgctcgacgacacggtgctgctcggcgtgccgaccaat
cgcgcgtttctcgcgcgcgtgctgcgccatcccgtattcgccgacgggcgcgcggtatcc
accgcgttcgtcgcggcgcacttccccgacaacgacagccgccgctgcgcgccgacgcaa
gccgtgtgggcgatcgccgcatggctgtcgacgctcgccgccgatcgcgccgacgcgctg
cccggcgcgtggcgcggctggcgcaacggcgcgccgctgccggtgccgtatcggctgtcc
ctcgcgaacgccggcgcggatcatccggacgcgcggcgcggcatcgtgacggccgagcgg
cagcgcgcggtcgtgcacgcgcaaggcggctcgccgatcgtgctcgacgcggcccgcccc
ccatgcccgggcgagccctcgacggtatcgatcgacggccgcgcgcatgcgtgctgcttc
gcgatcgcgcacggccggctgtggctgcaagtcgacggcgtcgatcacgcgttcgcgatc
cacaaccgcgaaggccgcgcgagcgccgcggcggccgacagcgacggcgtgctgcgcgcg
ccgatgaacggccgcgtgatcgcggtcgacatcgatgaaggcgcgaccgtatcggccggg
caaaccgtcatggtgctcgaggcgatgaagatggaacacgcaatcaccgcgccgttcgcg
ggccgaatcgcgtcgctcggcgcacgcccgggcgagcaggtctcacccggccaggtgctc
gcgcggctcgagccgcaggccggctga

DBGET integrated database retrieval system