KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A2815Help
Entry
BURPS1106A_A2815  CDS       T00480                                 

Gene name
rafA
Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bpl  Burkholderia pseudomallei 1106a
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bpl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BURPS1106A_A2815 (rafA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    BURPS1106A_A2815 (rafA)
   00600 Sphingolipid metabolism
    BURPS1106A_A2815 (rafA)
Enzymes [BR:bpl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BURPS1106A_A2815 (rafA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-Pathema: 
UniProt: 
Position
II:complement(2753383..2755593)
Genome map
AA seq 736 aa AA seqDB search
MQASRWGPPRARRMFDTKLIRLTGSNLSIALEKSADMPPVWRYFGAKLEPHAIAWSADDV
RPHPPTLLDGDPPFTAFSTHGFGWFHQPALVGSRPGDVGDIDWAQSFRLDEVSTNDHSVT
MKLSDEQAELGAILSYTIDPASDVITMWAELENRGATPFRVDWLAAATVPLPPDANRALS
FSGRWTLEFQENREILGSATWRRDNRRGRTSHDSFPGVMVGSSLADNVGTVYGAHLGWSG
NHTIIIEPMTDGRRQLQLGEWLAPGEVVLAPDQRYRTPCAFLSYSEQGLNGLSAQFHRFV
RAKVLRWPRQRMQPRPVILNTWEAVYCDHDLEDLKELATAGAQIGIERFVLDDGWFHCRD
NDRAGLGDWWPDANKYSRGLTPLIHHVRDLDMDFGLWIEPEMVNPDSELYRARPEWTLRL
DGRPLVTGRNQLVLDLAEPDVREYLFTQISALLRDNAISYLKWDMNRDLATAGHRGMPAY
RRQTQAFYALLDRLRAAFPAVEIESCASGGGRADYGVLARMHRLWTSDCNDALTRIGIQR
GFLRFFPPELMGAHIGADRSHTTGRRHTLAFRAAVALFGHLGVEVDPRAMPADEIEALMR
WIAIYKEWRPVLHAGTLHQGCVSEALSWTQAVSDDGSTSLLAIYRLREDNARYATPLKIK
GLRCDIAYRVQTLYAPVAPHFVKQTQMFKMMQNEGVVISGASLLELGMPIPPMPPESAVV
ISLKPASELSKPLDLY
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
ttgcaggcctcacgatgggggccaccaagggctagacgtatgttcgacacaaaacttatt
cgattgactggttcaaatctcagcatcgcactagagaaatcggccgatatgccgcctgta
tggcgctattttggcgcaaaattagaaccgcacgccatcgcctggagcgcagacgacgtg
cgaccgcaccctccgacgttactcgacggcgatccgcccttcacggcattctcgacacac
ggattcggctggttccatcaaccggcactcgtcggcagccggcctggagacgttggcgat
attgactgggcacagagctttcgccttgatgaggtaagcacaaacgatcactcggtaaca
atgaagttgagcgacgaacaggccgagttgggtgcaatccttagttacacaatcgatcct
gcgtcggacgtcataacgatgtgggctgaattagagaaccgcggcgcgactccattccgt
gtagattggctagccgccgccactgtaccgctgccgcccgacgcaaatcgggcactgagc
ttctcggggcgctggacgctggagttccaggaaaatcgtgaaattctcggttctgcgacg
tggaggcgcgacaaccgacgcgggcgcacttctcacgactcgtttccgggagtcatggtc
ggctcatcgctagcggacaatgtgggcaccgtatacggcgcgcatttgggatggagtgga
aaccacaccatcatcatcgaaccgatgaccgatggtcgccggcaactgcaattgggggaa
tggttggcaccgggcgaagtcgtgcttgcaccggaccaacgctatcgcacaccatgcgcc
tttctttcatacagcgagcagggcctgaatggcttgagcgcgcagttccaccgcttcgtt
cgggcgaaggtactgcgctggccacggcaacgcatgcaacctcggccggtgatcctcaat
acttgggaagccgtatattgcgatcacgatctcgaggatctcaaggaactggcgactgcg
ggggcgcagatcggcatcgaacgtttcgttctcgacgacggctggttccattgccgcgac
aacgatcgcgccggactaggcgactggtggcccgatgcgaacaagtactctcgcgggctc
acaccactcatccatcacgttcgagatttggacatggactttggcctatggatcgaaccc
gaaatggtcaatccggacagcgaattgtaccgcgcccgcccggagtggacgcttcggctc
gacggtcggccactcgtgacaggtcgcaatcagctcgtactggacctcgcggaaccagat
gtgcgcgaatatctcttcacgcaaatcagtgctttattgcgcgacaatgcgatttcctat
ctcaaatgggatatgaaccgagatctcgccacggctggccatcgtggcatgcccgcttac
aggcgtcagacccaggcgttttatgcgttgctcgatcggttgcgcgccgcgtttcctgct
gtggagatcgagagttgcgcctccgggggcggacgagccgattacggcgtgttggctcgc
atgcaccgtctctggacgagcgactgcaatgacgcgctcacgcgcatcggaattcagcgc
ggctttctgcgtttctttcctcccgagctcatgggtgcacatatcggggccgatcgttcc
cacacgaccggacgccggcacactcttgctttcagagccgcagtcgcacttttcggtcac
cttggcgttgaagtcgacccgagagcaatgcccgccgacgagatcgaagccctcatgcgc
tggattgcaatatacaaggaatggcggcccgttctacatgcgggaacccttcaccagggg
tgtgtcagcgaggcgctctcttggactcaagctgtctccgatgacggaagtacgtcgctt
ttggcgatctatcgactacgcgaggacaacgcgcgatacgccacaccactcaagatcaag
ggactgagatgcgacatcgcctatcgagtacaaacgctctacgcacctgtcgcaccacat
ttcgtgaagcaaacgcaaatgttcaagatgatgcagaacgaaggcgtggtgatttcgggc
gcaagtttgctggagttagggatgccaattcctcccatgccgcccgaatccgccgttgtg
atttcgctaaaacccgcctcggagttatccaagccgcttgatctgtattaa

DBGET integrated database retrieval system