KEGG   Burkholderia pseudomallei 1106a: BURPS1106A_A2882Help
Entry
BURPS1106A_A2882  CDS       T00480                                 

Definition
(GenBank) acetyltransferase, GNAT family
Organism
bpl  Burkholderia pseudomallei 1106a
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Succ_CoA_lig CoA_binding_2 Acetyltransf_1 Acetyltransf_3 ATP-grasp_5 Acetyltransf_7 Acetyltransf_10 Acetyltransf_8 Acetyltransf_CG FR47 Acetyltransf_9
Motif
Other DBs
NCBI-ProteinID: ABN93975
UniProt: A3P9A1
Position
II:complement(2819086..2821497)
Genome map
AA seq 803 aa AA seqDB search
MAARRSPSLNPFSGVAVTVRNLDALFHPTAVAVVGASPRPGSVGAMVWACVLDGRFGGAI
WPVNPKYGELNGHKVYPYVDQLPSAPSVALVCTPPATWPGIVRKLGGLGVRAAIIVGETR
SGADRAALERALAAAKPYLLRVVGPGSLGVVSPALGAHFGAPACIVKAGGVAWVSQSNAL
TNAVLGWAHARGLGFSHAVALGGEADVDAADVLDYLASDAETRAILLELDTVKSARKFMS
AARAAARNKPVLALRAGRGDSGDLLYTAAFQRAGMVRVDALDDLLDEIEALGVGRAAATS
GGVTLVTSDRGVAKLAVDALAAAGETLAQWPRAAVDEVGGALPAGIVAGNPLLLGDDARP
EYFGAALKALAQHPPTGTVFVVHATSHSAPAVDVARVLIESRKFARRGMLACFFGGVDAA
TRDALHVHGIPVHTTPQRLARAHARLVDYQLGRELLMQTPEGTPPQPAASISAARHTARA
ALAQGRDGFEGDAALEWLAGFGIECATDADVDMGDTIVDITVGMYDDPNFGPVFRYSVPP
ADGVSAPFVVYGLPPFNTVLARAVVARSPYAHRAPPEPLLQALTALSQAVCDVREIVEMS
LVLRVRPTRVVALGPHIRLATGRSRLAIVPYPRYLEQQLDWRGERITVRPIRPEDEAAHR
ELLSAMTPDDLRMRFFGAIRNFDHSQIARMTQIDYDREMALIATLDDADGRAHTLGAVRA
VTDPDNEATEFAIAVRPDQKGKGLGRMLMTRIIDYARSRGTAWMIGEALRENTAMISLAK
DSGFAVSSTEEPGVVAFRLKLQP
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
gtggccgcgcgtcgatcgccgtcgctcaatcctttcagcggagttgccgtgaccgttcgc
aatctcgatgcgttgttccatccgacagccgttgccgtcgtcggcgcttcgccgcgcccg
ggcagcgtcggcgcgatggtgtgggcgtgcgtgctcgacggccggttcggcggcgcgatc
tggcctgtcaacccgaagtacggcgaactgaacggccacaaggtttatccctatgtcgac
cagttgccgagcgcgccgtcggtcgcgctcgtatgcacgccgcccgcgacgtggcccggc
atcgtgcgcaagctgggcggtctgggcgtgcgtgcggcgatcatcgtcggcgagactcgt
tcgggcgcagaccgggccgcgctggaacgggcgcttgccgcggcgaagccatatctgctg
cgcgtcgtcgggccgggcagcctgggcgtggtgtcgcccgcgctgggcgcgcatttcggc
gcgccggcgtgcatcgtcaaggcgggtggcgtcgcatgggtgtcgcaatcgaatgcgctg
acgaacgcggtgctcggctgggcgcatgcgcgcgggctcggtttctcgcatgcggtcgca
ctcggcggcgaggcggatgtcgacgcggccgacgtgctcgactacctggcgagcgatgcc
gagacacgcgcgatcctgctcgagctcgacacggtgaaatcggcgcgcaagttcatgtcg
gcggcgcgcgccgcggcgcgcaacaagccggtgcttgcgttgcgcgcggggcgcggcgat
tcgggcgacctgctttacacggccgcgtttcagcgcgcggggatggtgcgcgtcgacgcg
ctcgacgatcttctcgacgagatcgaggcgctcggcgtcggccgtgccgcggcgacgagc
ggcggggtgacgctcgtcacgagcgacaggggcgtcgcgaagcttgccgtcgacgcactc
gcggcggcgggggaaacgctggcgcaatggccgcgggcggccgtcgacgaagtcggcggc
gcgctgcccgcgggcatcgtcgccggcaatccgttgctgctcggcgacgacgcgcggccc
gaatatttcggcgcggcgctgaaggcgctcgcgcagcatccgccgacaggcaccgtgttc
gtggttcatgcgacgtcgcatagcgcgcctgccgtcgacgtcgcacgtgtgctgatcgaa
tcgcgcaagttcgcgcgtcgcggcatgctcgcgtgcttcttcggcggcgtcgacgccgcg
acgcgcgacgcgctgcacgtgcacggcatccccgtgcacacgacgccgcagcgtctcgcg
cgcgcgcatgcgcgccttgtcgattatcaattgggccgggagctgttgatgcagacgccg
gagggcacgccgccgcaaccggcggcgtcgatctcggccgcgcggcacacggcgcgcgcg
gcgctcgcgcaggggcgcgacgggttcgaaggcgacgcggcgctcgaatggctggcgggt
ttcggcatcgagtgcgcgaccgacgcggacgtcgatatgggcgatacgatcgtcgacatc
acggtcgggatgtacgacgacccgaacttcgggccggtattccgctattcggtgccgccg
gcggatggcgtgtccgcgccgttcgtcgtctacgggctgccgcctttcaataccgtgctc
gcgcgcgcggtcgtcgcgcgatcgccgtatgcgcatcgcgcgccgcccgagccgcttctg
caggcactgaccgcgctttcgcaggcggtgtgcgatgtgcgcgaaatcgtcgagatgtcg
ctcgtgctgcgcgtgcggcccacacgcgtggtcgcgcttgggccgcacatcaggctcgcg
acggggcgcagccggctcgcgatcgtgccatatccgcgctatctcgagcagcagctcgac
tggcgcggagaacgcatcacggtgcgtccgattcgccccgaggacgaggccgcgcatcgc
gagctgctgagcgcgatgacgccggacgatctgcgaatgcgcttcttcggtgcgatacgc
aacttcgaccattcgcagatcgcgcggatgacgcagatcgattacgaccgcgagatggcg
ctgatcgcgacgctcgacgatgccgacggccgcgcgcatacgctcggcgcggtgcgcgcg
gtgaccgatccggacaacgaagcgacggagttcgcgatcgcggtgcggcctgaccaaaag
ggcaaggggctcggacggatgttgatgacgcgcatcatcgactacgcgcgctcgcgcgga
acggcgtggatgatcggcgaggcactgcgcgagaacacggcgatgatctcgctcgcgaag
gatagcggttttgcggtgtcgtcgaccgaggagcctggggtggtggcgttccggctgaag
ctgcagccgtga

DBGET integrated database retrieval system