KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_0202Help
Entry
BURPS1710b_0202   CDS       T00289                                 

Gene name
mmsA
Definition
(GenBank) methylmalonate-semialdehyde dehydrogenase
  KO
K00140  malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm00280  Valine, leucine and isoleucine degradation
bpm00410  beta-Alanine metabolism
bpm00562  Inositol phosphate metabolism
bpm00640  Propanoate metabolism
bpm01100  Metabolic pathways
bpm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BURPS1710b_0202 (mmsA)
   00562 Inositol phosphate metabolism
    BURPS1710b_0202 (mmsA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BURPS1710b_0202 (mmsA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BURPS1710b_0202 (mmsA)
Enzymes [BR:bpm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     BURPS1710b_0202 (mmsA)
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     BURPS1710b_0202 (mmsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ABA47947
UniProt: Q3JXT5
Position
I:complement(210039..211565)
Genome map
AA seq 508 aa AA seqDB search
MTGSTHSNDSRVRALAHFIGGRALDGASDRYGDVFDPALGTVTARVPLASGAEVDAAVAA
AAAAFPAWSETSPLKRARVMFKFKELLDRHHDELAELITREHGKVFSDAKGEVMRGIEVV
EFACGIPNLLKTDFTDQIGGGIDNWNLRQPLGVVAGITPFNFPMMVPCWMFPVAIACGNT
FVLKPSERDPSASIRLAELLKEAGLPDGVFNVVHGDKTAVDALIAHPDVAALSFVGSTPI
AEYIHTQAARRGKRVQALGGAKNHLVVMPDANLDQAVDALVGAAYGSAGERCMAISVAVA
VGGVADALVERLAERAKALKIGNGMNADVEMGPLVTAAHRAKVSAYIDAGVAAGAKLVVD
GRRHVVAGGENGFFLGGTLFDDVTTDMSIYREEIFGPVLAVVRVPDFASAVELINAHEFA
NGVSCFTSDGGIARAFARKIQVGMVGINVPIPVPMAWHSFGGWKRSLFGDHHAYGEEGVR
FYTRYKSVMQRWPDSIAKGAEFTMPVAK
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcagcacccattcgaacgattcgcgcgtgcgcgcactggcccatttcatcggc
gggcgcgcgctcgacggcgcgagcgaccgttacggcgacgtgttcgatccggccctcggc
acggtgacggcgcgcgtgccgctcgcgagcggcgcggaagtcgatgcggccgtcgccgcc
gcggccgccgcgttccccgcgtggagcgagacctcgccgctcaagcgcgcgcgcgtgatg
ttcaagttcaaggagctgctcgaccgccatcacgacgagctcgccgagctgatcacccgc
gagcacggcaaggtgttctcggatgcgaagggcgaggtgatgcgcggaatcgaggtggtc
gaattcgcgtgcggcattccgaatctgctgaagaccgacttcaccgaccagatcggcggc
ggcatcgacaactggaacctgcggcagccgcttggcgtcgtcgccggcatcacgccgttc
aattttccgatgatggtgccgtgctggatgtttccggtggcgatcgcgtgcggcaacacg
ttcgtgctcaagccttccgagcgcgatccgtcggcgtcgatccggctcgccgagctgctg
aaggaagcggggctgcccgacggcgtgttcaacgtcgtgcacggcgacaagacggccgtc
gacgcgctgatcgcgcatccggacgtggccgcgctgtcgttcgtcggctcgacgccgatc
gccgagtacattcacacgcaagccgcgcgccgcggcaagcgcgtgcaggcgctcggcggc
gcgaagaaccatctcgtcgtgatgccggacgcgaacctcgatcaggcagtggacgcgctc
gtcggcgccgcgtacggctcggcgggcgagcgctgcatggcgatttccgtcgcggtcgcg
gtgggcggcgtcgccgacgcgctcgtcgagcggctcgccgagcgtgcgaaggcgctgaag
atcggcaacgggatgaacgccgacgtcgaaatggggccgctcgtgacggccgcgcatcgc
gcgaaggtgtccgcgtacatcgacgccggcgtcgcggcgggcgcgaagctcgtcgtcgac
gggcgccggcacgtcgtcgccggcggcgagaacggcttcttcctcggcggcacgctgttc
gacgacgtgacgaccgacatgtcgatctatcgcgaggaaatcttcgggccggtgctggcc
gtcgtgcgggtgccggatttcgcgagcgcggtcgagctcatcaacgcgcacgagttcgcc
aacggcgtgtcgtgcttcacgtccgacggcggcatcgcgcgcgcgttcgcgcggaagatc
caggtcgggatggtgggcatcaacgtgccgatcccggtgccgatggcgtggcattcgttc
ggcggctggaagcgctcgctgttcggcgatcaccacgcatacggcgaggagggcgtgcgt
ttctacacgcgctacaagagcgtgatgcagcgctggccggacagcatcgcgaagggcgcg
gagttcacgatgcctgtcgcgaagtga

DBGET integrated database retrieval system