KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_0202Help
Entry
BURPS1710b_0202   CDS       T00289                                 

Gene name
mmsA
Definition
methylmalonate-semialdehyde dehydrogenase (EC:1.2.1.27)
Orthology
K00140  
malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Inositol phosphate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bpm01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bpm00640]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:bpm00562]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:bpm00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:bpm00410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(210039..211565)
Genome map
AA seq 508 aa AA seqDB search
MTGSTHSNDSRVRALAHFIGGRALDGASDRYGDVFDPALGTVTARVPLASGAEVDAAVAA
AAAAFPAWSETSPLKRARVMFKFKELLDRHHDELAELITREHGKVFSDAKGEVMRGIEVV
EFACGIPNLLKTDFTDQIGGGIDNWNLRQPLGVVAGITPFNFPMMVPCWMFPVAIACGNT
FVLKPSERDPSASIRLAELLKEAGLPDGVFNVVHGDKTAVDALIAHPDVAALSFVGSTPI
AEYIHTQAARRGKRVQALGGAKNHLVVMPDANLDQAVDALVGAAYGSAGERCMAISVAVA
VGGVADALVERLAERAKALKIGNGMNADVEMGPLVTAAHRAKVSAYIDAGVAAGAKLVVD
GRRHVVAGGENGFFLGGTLFDDVTTDMSIYREEIFGPVLAVVRVPDFASAVELINAHEFA
NGVSCFTSDGGIARAFARKIQVGMVGINVPIPVPMAWHSFGGWKRSLFGDHHAYGEEGVR
FYTRYKSVMQRWPDSIAKGAEFTMPVAK
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcagcacccattcgaacgattcgcgcgtgcgcgcactggcccatttcatcggc
gggcgcgcgctcgacggcgcgagcgaccgttacggcgacgtgttcgatccggccctcggc
acggtgacggcgcgcgtgccgctcgcgagcggcgcggaagtcgatgcggccgtcgccgcc
gcggccgccgcgttccccgcgtggagcgagacctcgccgctcaagcgcgcgcgcgtgatg
ttcaagttcaaggagctgctcgaccgccatcacgacgagctcgccgagctgatcacccgc
gagcacggcaaggtgttctcggatgcgaagggcgaggtgatgcgcggaatcgaggtggtc
gaattcgcgtgcggcattccgaatctgctgaagaccgacttcaccgaccagatcggcggc
ggcatcgacaactggaacctgcggcagccgcttggcgtcgtcgccggcatcacgccgttc
aattttccgatgatggtgccgtgctggatgtttccggtggcgatcgcgtgcggcaacacg
ttcgtgctcaagccttccgagcgcgatccgtcggcgtcgatccggctcgccgagctgctg
aaggaagcggggctgcccgacggcgtgttcaacgtcgtgcacggcgacaagacggccgtc
gacgcgctgatcgcgcatccggacgtggccgcgctgtcgttcgtcggctcgacgccgatc
gccgagtacattcacacgcaagccgcgcgccgcggcaagcgcgtgcaggcgctcggcggc
gcgaagaaccatctcgtcgtgatgccggacgcgaacctcgatcaggcagtggacgcgctc
gtcggcgccgcgtacggctcggcgggcgagcgctgcatggcgatttccgtcgcggtcgcg
gtgggcggcgtcgccgacgcgctcgtcgagcggctcgccgagcgtgcgaaggcgctgaag
atcggcaacgggatgaacgccgacgtcgaaatggggccgctcgtgacggccgcgcatcgc
gcgaaggtgtccgcgtacatcgacgccggcgtcgcggcgggcgcgaagctcgtcgtcgac
gggcgccggcacgtcgtcgccggcggcgagaacggcttcttcctcggcggcacgctgttc
gacgacgtgacgaccgacatgtcgatctatcgcgaggaaatcttcgggccggtgctggcc
gtcgtgcgggtgccggatttcgcgagcgcggtcgagctcatcaacgcgcacgagttcgcc
aacggcgtgtcgtgcttcacgtccgacggcggcatcgcgcgcgcgttcgcgcggaagatc
caggtcgggatggtgggcatcaacgtgccgatcccggtgccgatggcgtggcattcgttc
ggcggctggaagcgctcgctgttcggcgatcaccacgcatacggcgaggagggcgtgcgt
ttctacacgcgctacaagagcgtgatgcagcgctggccggacagcatcgcgaagggcgcg
gagttcacgatgcctgtcgcgaagtga

DBGET integrated database retrieval system