KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_0287Help
Entry
BURPS1710b_0287   CDS       T00289                                 

Gene name
fadB
Definition
fatty oxidation complex subunit alpha (EC:5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BURPS1710b_0287 (fadB)
   01212 Fatty acid metabolism
    BURPS1710b_0287 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BURPS1710b_0287 (fadB)
   00650 Butanoate metabolism
    BURPS1710b_0287 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    BURPS1710b_0287 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    BURPS1710b_0287 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BURPS1710b_0287 (fadB)
   00310 Lysine degradation
    BURPS1710b_0287 (fadB)
   00380 Tryptophan metabolism
    BURPS1710b_0287 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BURPS1710b_0287 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BURPS1710b_0287 (fadB)
   00281 Geraniol degradation
    BURPS1710b_0287 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    BURPS1710b_0287 (fadB)
Enzymes [BR:bpm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     BURPS1710b_0287 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BURPS1710b_0287 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     BURPS1710b_0287 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:293123..295246
Genome map
AA seq 707 aa AA seqDB search
MIDYTLDDDGIATLSWNLPARSQNVLNGESCEAFFAAAARALQDAAVKGMLVTSAKPDFI
AGGDLEWLQASDSAETLFARTCELHRALRALETGGKPVAIAMPGSALGGGLEIALAGHYR
VAADNPKARFGLPEVTLGLLPGGGGTQRLPRLVGVQASLPLLLEGKRLKAADALAAGILH
AVVPAGEEIAAARAWLLDASRRTATQPWDAKGFRIPGGALTHPSVQQVFMAANALARQKT
YGNYPAVANILSCVYEGLLTDLDTGLKTEARYFVKAVLSPEAKAMIRTLFFGMNEANKLA
ARPAGVPTQRYRKVGVLGAGMMGAGIAYVSAKAGLDVVLIDTGEEAAARGKDYSRKLVDK
QVQRGRLAREKADALLAKIVPTTDFARLDGAQLVIEAVFEDRAIKADVTRRSEAVLAPDA
LFASNTSTLPITGLAQASARPANFIGLHFFSPVDKMPLVEVIVGRDTSEATLARALDYVK
TIGMTPIVVNDSRGFYTSRVFSTYVLEGLAMLAEGVAPALIENAGLLAGMPVGPLALTDE
VSSELIHKITRQTRADLGDAYVARPGEDVAARMVELGRLGRKAGLGYYDYPASGGKKALW
PGLAQEFPLAAEQPDVAALIERLVTVQAVETARCLEERVLTTARDADVGAILGWGFPAFR
GGPASYIHGVGVDAFVATCDRLAARHGARFAAPALLREMAAQGRSFY
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgatcgattacacgctcgatgacgacggcatcgcgaccttgagctggaacctgccggcg
cgcagccagaacgtgctgaacggcgagagctgcgaggcgttcttcgcggcggcggcgcgc
gcgttgcaggatgcggcggtgaagggaatgctcgtcacgtcggcgaagcccgacttcatc
gcgggcggcgacctcgaatggctgcaggcgagcgacagcgccgagacgctcttcgcgcgc
acgtgcgagctgcatcgcgcgctgcgcgcgctcgaaacaggcggcaagccggtggcgatc
gcgatgccgggctcggcgctcggcggtgggctggagatcgcgctcgcgggccactatcgt
gtcgcggccgacaatccgaaggcgcgcttcggcctgcccgaagtgacgctcggcctgctg
ccgggcggcggcggcacgcagcgcctgccgcgtctcgtcggcgtccaggcgtcgctgccg
ctgttgctcgaaggcaagcggctgaaggcggccgacgcgctggccgcgggcatcctgcat
gcggtcgtgccggcgggcgaggagatcgcggccgcgcgcgcgtggctgctcgacgcgagc
cgccgcaccgcgacgcagccgtgggacgcgaagggcttccggattccgggcggcgcgctc
acgcatccgtccgtccagcaggtgttcatggcggcgaacgcgctcgcgcggcagaagacg
tatggcaactacccggccgtcgcgaacatcctgtcgtgcgtgtacgaagggctgctgacc
gatctcgacacgggcttgaagaccgaggcgcgctatttcgtgaaggcggtgctgtcgccg
gaagcgaaggcgatgatccgcacgctgttcttcgggatgaacgaagcgaacaagctcgcc
gcgcggccggccggcgtgccgacgcagcgctaccggaaggtcggcgtgctcggcgcgggg
atgatgggcgcgggcatcgcgtacgtgagcgcgaaggcggggctcgacgtcgtgctgatc
gataccggcgaagaggcggccgcgcgcggcaaggactattcgcgcaagctcgtcgacaag
caggtgcagcgcggccggctcgcgcgggaaaaggccgatgcattgctcgcgaagatcgtg
ccgacgaccgatttcgcgcggctcgacggcgcgcagctcgtgatcgaggcggtgttcgag
gatcgcgcgatcaaggccgacgtcacgcgcaggagcgaagcggtgctcgcgcccgacgcg
cttttcgcgtcgaacacgtcgacgctgccgatcacggggctcgcgcaggcgagcgcgcgg
ccggcgaacttcatcggcctgcatttcttctcgccggtggacaagatgccgctcgtcgag
gtgatcgtcggccgcgacacgagcgaggcgacgctcgcgcgcgcgctcgactacgtgaag
acgatcggcatgacgccgatcgtggtcaacgattcgcggggcttctacacgagccgcgtg
ttttcgacgtacgtgctcgaagggctcgcgatgctcgccgagggcgtcgcgcccgcgctg
atcgagaacgccggattgctcgccggcatgccggtgggcccgctcgcgctgaccgacgag
gtgtcgagcgagctgatccacaagatcaccaggcagacgcgcgccgatctcggcgacgcg
tacgtcgcgcgccccggcgaggacgtggccgcgcgcatggtcgaactcggccggctcggc
cgcaaggcggggctcggctattacgactatccggcgagcggcggcaagaaggcgctgtgg
ccggggctcgcgcaggagtttccgctcgcggccgagcagcccgacgtggcggcgctgatc
gagcggctcgtgacggtgcaggcggtcgagaccgcgcgctgcctcgaagagcgcgtgctg
acgacggcgcgcgatgcggacgtcggcgcgattctcggctggggtttcccggcgttccgc
ggcgggccggcgtcgtacattcacggcgtcggggtggacgcgttcgtcgcgacgtgcgat
cgtcttgccgcgcggcacggcgcgcgtttcgccgcgccggcgttgctgcgcgagatggcg
gcgcaggggcgaagcttctattga

DBGET integrated database retrieval system