KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_0319Help
Entry
BURPS1710b_0319   CDS       T00289                                 

Definition
YaeQ protein (EC:1.6.99.3)
Orthology
K00356  
NADH dehydrogenase [EC:1.6.99.3]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    BURPS1710b_0319
Enzymes [BR:bpm01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With other, unknown, acceptors
    1.6.99.3  NADH dehydrogenase
     BURPS1710b_0319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:334231..334785
Genome map
AA seq 184 aa AA seqDB search
MALKSTIYKAELQIADMDRHYYADHSLTVARHPSETDERMMVRIAAFALFAHERLEFCKG
LSDTDEPDLWQKDLTGAIEVWIDVGQPDERRIAKASGRAGRVNVIAYGGRTSDIWWQGAR
GKVERLRNVQVTTLADGVAAALGGLAERTMRLQCTIQDGAAWLSSATHDPVAIEWTTLKA
REDA
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcaaatcgacgatctacaaggcggagctgcaaatcgccgacatggatcggcac
tactatgccgatcactcgctcaccgtcgcccgtcacccgtccgaaacggacgagcggatg
atggtgcgtatcgccgcgttcgcgctgttcgcgcacgagcggctcgagttctgcaagggg
ctgtcggataccgacgagcccgatctttggcaaaaagacctgacgggggcgatcgaggta
tggatcgacgtcgggcagcccgacgagcgccgtatcgcgaaggcaagcggccgagccggc
cgcgtgaacgtgatcgcgtacggcggacgcacgtccgacatctggtggcagggcgcgcgc
ggcaaggtcgagcggctgcgcaacgtgcaggtgacgacgctcgccgacggcgtcgcggcg
gcgctcggcggcctcgccgagcgcacgatgcgtctgcagtgcacgatccaggatggcgcc
gcctggctgtcgagcgcgacgcatgatccggtcgcgatcgagtggacgacgctgaaggcg
cgcgaagacgcctga

DBGET integrated database retrieval system