KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_0319Help
Entry
BURPS1710b_0319   CDS       T00289                                 

Definition
YaeQ protein (EC:1.6.99.3)
Organism
bpm  Burkholderia pseudomallei 1710b
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:334231..334785
Genome map
AA seq 184 aa AA seqDB search
MALKSTIYKAELQIADMDRHYYADHSLTVARHPSETDERMMVRIAAFALFAHERLEFCKG
LSDTDEPDLWQKDLTGAIEVWIDVGQPDERRIAKASGRAGRVNVIAYGGRTSDIWWQGAR
GKVERLRNVQVTTLADGVAAALGGLAERTMRLQCTIQDGAAWLSSATHDPVAIEWTTLKA
REDA
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcaaatcgacgatctacaaggcggagctgcaaatcgccgacatggatcggcac
tactatgccgatcactcgctcaccgtcgcccgtcacccgtccgaaacggacgagcggatg
atggtgcgtatcgccgcgttcgcgctgttcgcgcacgagcggctcgagttctgcaagggg
ctgtcggataccgacgagcccgatctttggcaaaaagacctgacgggggcgatcgaggta
tggatcgacgtcgggcagcccgacgagcgccgtatcgcgaaggcaagcggccgagccggc
cgcgtgaacgtgatcgcgtacggcggacgcacgtccgacatctggtggcagggcgcgcgc
ggcaaggtcgagcggctgcgcaacgtgcaggtgacgacgctcgccgacggcgtcgcggcg
gcgctcggcggcctcgccgagcgcacgatgcgtctgcagtgcacgatccaggatggcgcc
gcctggctgtcgagcgcgacgcatgatccggtcgcgatcgagtggacgacgctgaaggcg
cgcgaagacgcctga

DBGET integrated database retrieval system