KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_0603Help
Entry
BURPS1710b_0603   CDS       T00289                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm00071  Fatty acid degradation
bpm00280  Valine, leucine and isoleucine degradation
bpm00281  Geraniol degradation
bpm00310  Lysine degradation
bpm00360  Phenylalanine metabolism
bpm00362  Benzoate degradation
bpm00380  Tryptophan metabolism
bpm00410  beta-Alanine metabolism
bpm00627  Aminobenzoate degradation
bpm00640  Propanoate metabolism
bpm00650  Butanoate metabolism
bpm00903  Limonene and pinene degradation
bpm00930  Caprolactam degradation
bpm01100  Metabolic pathways
bpm01110  Biosynthesis of secondary metabolites
bpm01120  Microbial metabolism in diverse environments
bpm01130  Biosynthesis of antibiotics
bpm01212  Fatty acid metabolism
Module
bpm_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BURPS1710b_0603
   00650 Butanoate metabolism
    BURPS1710b_0603
  Lipid metabolism
   00071 Fatty acid degradation
    BURPS1710b_0603
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BURPS1710b_0603
   00310 Lysine degradation
    BURPS1710b_0603
   00360 Phenylalanine metabolism
    BURPS1710b_0603
   00380 Tryptophan metabolism
    BURPS1710b_0603
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BURPS1710b_0603
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BURPS1710b_0603
   00281 Geraniol degradation
    BURPS1710b_0603
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BURPS1710b_0603
   00627 Aminobenzoate degradation
    BURPS1710b_0603
   00930 Caprolactam degradation
    BURPS1710b_0603
Enzymes [BR:bpm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BURPS1710b_0603
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABA49793
UniProt: Q3JWN6
Position
I:616058..617038
Genome map
AA seq 326 aa AA seqDB search
MRRRPGRIARRAAVPPDARRVSPDDPAARLRYTGFAGLSAHPTLHFEGRSSMTDLALYAG
YEALRIQRRPHGIVEIVMSGEGANRSGLAVASEAMHRELADIWRDVDRDPDARVAVIRGE
GKGFSAGGDLALVERMADAHAVRERVWREARDLVYNVINCSKPIVSAMHGPAVGAGLVAG
LLADVSIAAKHARIIDGHTRLGVAAGDHAAIVWPLLCGMAKAKYHLLLCEPVSGEEAERI
GLVSLALDDHELLPKAYEIAERLAQGSQSAIRWTKYALNNWLRLAGPTFDASLALEFMGF
SGPDVREGIRSLRERRAPDFTGGAPS
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgcggcgccgcccgggccggattgcccgccgggccgccgtgccgcccgacgcgcgccgg
gtttcgccggatgaccctgccgcccgccttcgctacactggatttgcaggcttgtcggct
caccccacactccacttcgaaggaaggtccagcatgaccgatctcgctctctatgccggc
tatgaagcgctgcgcatccagcgccggccgcacggcatcgtcgaaatcgtgatgagcggc
gaaggcgcgaaccgcagcggcctcgcggtcgcgagcgaggcgatgcaccgcgagctcgcc
gatatctggcgcgacgtcgaccgcgatcccgacgcgcgcgtcgcggtgatccgcggcgaa
ggcaagggcttctcggcgggcggcgatctcgcgctcgtcgagcgcatggccgacgctcac
gcggtgcgcgagcgcgtctggcgcgaagcgcgcgatctcgtctacaacgtgatcaattgc
agcaagccgatcgtgtcggcgatgcacgggccggccgtcggcgccgggctcgtcgccggg
ctgctcgccgacgtgtcgatcgccgcgaagcacgcgcggatcatcgacgggcacacgcgt
ctcggcgtcgccgcgggcgatcacgcggcgatcgtctggccgctgctctgcgggatggcg
aaggcgaaataccacctgctcctctgcgagcccgtgagcggcgaggaggccgagcgcatc
gggctcgtgtcgctcgcgctcgacgatcacgagctgctgccgaaggcgtacgagatcgcc
gagcgcctcgcgcaaggctcgcaaagcgcgatccgctggaccaagtacgcgctcaacaac
tggctgcggctggccgggccgaccttcgacgcgtcgctcgcgctcgaattcatgggtttt
tccgggccggacgtgcgcgaaggcattcgctcgctgcgcgagcgccgcgcgccggatttc
acgggcggcgcgccgtcttga

DBGET integrated database retrieval system