KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_0662Help
Entry
BURPS1710b_0662   CDS       T00289                                 

Gene name
gpmA
Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm00010  Glycolysis / Gluconeogenesis
bpm00260  Glycine, serine and threonine metabolism
bpm00680  Methane metabolism
bpm01100  Metabolic pathways
bpm01110  Biosynthesis of secondary metabolites
bpm01120  Microbial metabolism in diverse environments
bpm01130  Biosynthesis of antibiotics
bpm01200  Carbon metabolism
bpm01230  Biosynthesis of amino acids
Module
bpm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bpm_M00002  Glycolysis, core module involving three-carbon compounds
bpm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BURPS1710b_0662 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BURPS1710b_0662 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BURPS1710b_0662 (gpmA)
Enzymes [BR:bpm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BURPS1710b_0662 (gpmA)
Membrane trafficking [BR:bpm04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BURPS1710b_0662 (gpmA)
Exosome [BR:bpm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BURPS1710b_0662 (gpmA)
  Exosomal proteins of melanoma cells
   BURPS1710b_0662 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABA50316
UniProt: Q3JWH7
Structure
PDB: 

Jmol
Position
I:complement(675293..676042)
Genome map
AA seq 249 aa AA seqDB search
MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNREARQAGQLLKEAGYTFDIAYTSVLKR
AIRTLWHVQDQMDLMYVPVVHSWRLNERHYGALSGLNKAETAAKYGDEQVLVWRRSYDTP
PPALEPGDERAPYADPRYAKVPREQLPLTECLKDTVARVLPLWNESIAPAVKAGKQVLIA
AHGNSLRALIKYLDGISDADIVGLNIPNGVPLVYELDESLTPIRHYYLGDQEAIAKAQAA
VAQQGKSAA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagctcgttctcatccgccacggcgaatcgacgtggaacaaggaaaaccgcttc
accggctgggtcgatgtcgacctgaccgaacaaggcaatcgcgaagcccggcaggcgggc
cagctcctgaaggaagccggctacacgttcgatatcgcatacacgtcggtgctcaagcgc
gcgatccgcacgctctggcacgtgcaggaccagatggatctgatgtacgtgcccgtcgtg
cattcgtggcgcctgaacgagcgccattacggcgcgctgtcgggcctgaacaaggcggag
acggccgcgaagtacggcgacgagcaggtgctcgtctggcgccgcagctacgacacgccg
ccgcccgcgctcgagccgggcgacgagcgcgcgccgtacgccgatccgcgctacgcgaag
gtgccgcgcgagcagttgccgctcaccgagtgcctgaaggacacggtcgcgcgcgtgctg
ccgctctggaacgaatcgatcgcgcccgcggtgaaggccggcaagcaggtgctgatcgcc
gcgcacggcaactcgctgcgcgcgctgatcaagtatctcgacggcatctccgacgcggac
atcgtcggcctgaacatcccgaacggcgtgccgctcgtctacgagctcgacgagagcctc
acgcccatccggcactactacctcggcgatcaggaggcgatcgcgaaggcgcaggccgcc
gtcgcgcagcagggcaagtccgcggcataa

DBGET integrated database retrieval system