KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_1177Help
Entry
BURPS1710b_1177   CDS       T00289                                 

Gene name
holC
Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BURPS1710b_1177 (holC)
   00240 Pyrimidine metabolism
    BURPS1710b_1177 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    BURPS1710b_1177 (holC)
   03430 Mismatch repair
    BURPS1710b_1177 (holC)
   03440 Homologous recombination
    BURPS1710b_1177 (holC)
Enzymes [BR:bpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     BURPS1710b_1177 (holC)
DNA replication proteins [BR:bpm03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     BURPS1710b_1177 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1221778..1222194
Genome map
AA seq 138 aa AA seqDB search
MTRIDFHTNVGDSLAYACRLLRKAYQAGQPVVVCAEPARLRALDERLWTFSPLDFIPHCA
IDNAHAASTPIVLTADLERAPHHGILLNLGAQVPAQFARFERLLEVVGNAPDELAAGRDR
YRFYRDRGYALNNHKQGG
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggatcgatttccatacgaatgtcggcgattcgctcgcgtacgcgtgccggctg
ctgcgcaaggcgtatcaggcggggcagcccgtcgtcgtgtgcgcggagcccgcgcggctg
cgcgcgctcgacgagcgtctgtggacgttctcgccgctcgatttcattccgcattgcgcg
atcgacaacgcgcacgcggcgagcacgccgatcgtgctgaccgcggatctcgagcgcgcg
ccgcatcacgggatcctgctgaacctgggcgcgcaggtgccggcgcagttcgcgcgcttc
gagcgcctgctcgaggtggtcggcaacgcgcccgacgagctcgcggccggccgcgaccgg
tatcggttctatcgcgatcgcggctacgcgctcaacaatcacaagcagggcggctag

DBGET integrated database retrieval system