KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_1432Help
Entry
BURPS1710b_1432   CDS       T00289                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BURPS1710b_1432 (tpiA)
   01230 Biosynthesis of amino acids
    BURPS1710b_1432 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BURPS1710b_1432 (tpiA)
   00051 Fructose and mannose metabolism
    BURPS1710b_1432 (tpiA)
   00562 Inositol phosphate metabolism
    BURPS1710b_1432 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BURPS1710b_1432 (tpiA)
Enzymes [BR:bpm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BURPS1710b_1432 (tpiA)
Exosome [BR:bpm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BURPS1710b_1432 (tpiA)
  Exosomal proteins of bladder cancer cells
   BURPS1710b_1432 (tpiA)
  Exosomal proteins of melanoma cells
   BURPS1710b_1432 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1508142..1508897
Genome map
AA seq 251 aa AA seqDB search
MSKQRIKRVIGNWKMHGRLSGNEALLDEVAQGAQAVPEHVGIGVCVPFPYLAQARARLHG
GRVAWGAQDVSAHEQGAFTGEVAAGMVAEFGAAYAIVGHSERRAYHGESNEIVAAKAQRA
LAAGLTPVVCVGETLAEREAGATEQVVGVQLDAVLAVLSQDEAVRIVVAYEPVWAIGTGR
SATAEQAQQVHAFLRGRLAAKGAERVSLLYGGSVKADNAAELFGQPDIDGGLIGGASLKS
GDFLAICRAAQ
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacaaagaatcaagcgggtgatcggcaactggaagatgcacggtcgcctgagc
ggcaacgaggcgctgctcgacgaagtcgcgcagggcgcgcaagccgtgcccgagcacgtc
ggcatcggagtgtgcgtgccgtttccgtatctcgcgcaggcgcgggcccggcttcacggc
ggtcgcgtcgcgtggggcgcgcaggacgtgtccgcgcacgagcagggcgcctttaccggc
gaagtcgcggccggcatggtcgcggagttcggcgcggcgtacgcgatcgtcgggcactcg
gagcgccgcgcgtatcacggcgaatcgaacgagatcgtcgcggcgaaggcgcaacgtgcg
ctcgccgcggggctgacgcccgtcgtgtgcgtcggcgagacgctcgccgagcgcgaagcg
ggggcgaccgagcaggtcgtcggcgtgcagctcgacgcggtgctcgcggtgctgtcgcag
gacgaggcggtgcgcatcgtcgtcgcgtacgagcccgtatgggcgatcggcacgggccgc
agcgcgacggcggagcaggcgcagcaggtgcacgcgttcctgcgcgggcggctcgcggcg
aagggcgccgagcgcgtgtcgctgctgtatggcggcagcgtgaaggccgacaacgcggcc
gagctgttcggccagcctgacatcgacggcggcctgatcggcggcgcgtcgttgaagagc
ggggatttcctggcgatttgccgggcggcgcagtaa

DBGET integrated database retrieval system