KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_1521Help
Entry
BURPS1710b_1521   CDS       T00289                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bpm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1607026..1609722
Genome map
AA seq 898 aa AA seqDB search
MSVVDERFAWTGGLADRLPEPADFGLALAEGFARRIGMLSRRVGASAAAARWAARAAFAA
SRATAAGHVCVALRALAQRYDEPYDDVRAALAASGVTAFDGIVRGGECPLVVDRDGRLYL
ARYFEYETRLANALVERSRCGGAPAGGADALSPDALGERLVRYFGPQKERGVDWQRVAAL
IALTGRVTIVSGGPGTGKTTTVVGVIACLLDAHPELRIALAAPTGKAAQRMQEALHARAG
SLPAELAARLPRTSCTLHRLLGGGPGGRFAHHRDNPLPYDLVVVDEASMIDVALAAHLLD
ALAPNARLVLLGDKDQLAAVEAGAVFAELSARPAFSPATCATIARALGVGEAEFVAALPD
GFVVQAVGAERVADARAAAADMDVAARGTAGAAAAAARATAAAAARMTTAAAAARGGAPE
SAAQRAPAPHAGRRGGGRASNRTVDDAQGSLFAFDDDAFGVGTSGGEPGAGAQGAGRRDG
GAPSLDEPHAGRRDGGASPGVAHSRRDAFDARARSGPADVSDLENAARAYAPAGAAGPAD
SPADASFVEPAAWIEADELAWLDNAVFSFSEGASANAEADGRRSAAATATDAGARTAPPV
AREATAPTPRETARSDGSAVAPLTDCVVWLERNYRFGLDSPIGRLSLAIRRGAVQDALDA
LSTQDDAAARFSDDGGATLSAATVEQLARGFAGYAAALRDALATPEPDALPLFDVLNRFR
VLCATRTGARGAEEVNARMAAEVRRAVRVPLALGAHWFAGRPVMVTRNDYALGLFNGDIG
IALPGARGALRVWFRGADGRARAVSPAALPPHDTAFALTVHKSQGSEFDDAALILPASFN
RVLSRELVYTAITRARARVQVIGSRAVLALAIATRTARDSGLAARIADALRARQEGAR
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtggtcgacgaacgtttcgcgtggacgggcggcctggcggaccgtctgcccgag
ccggccgatttcgggctcgcgctcgccgaaggcttcgcgcgccggatcgggatgctgtcg
cggcgtgtcggcgcgagcgccgcggccgcgcgctgggcggcacgcgcggcgttcgccgcg
agccgcgcgacggcggcggggcacgtatgcgtcgcgctgcgcgcgctcgcgcagcgctac
gacgagccgtacgacgacgtacgcgcggcgctcgccgcgagcggcgtgaccgcgttcgac
ggcatcgtgcgcggcggcgagtgcccactcgtcgtcgatcgcgatggtcggctgtatctc
gcgcgctacttcgaatacgagacgcggctcgcgaacgcgctcgtcgagcggagccgatgc
ggcggcgcgccggcgggcggcgccgatgcgctctcgcccgacgcgctcggcgagcggctc
gtccgctatttcgggccgcagaaggagcggggcgtcgattggcagcgcgttgcggcgctc
atcgcgctcacgggccgcgtgacgatcgtgagcggcgggccgggcaccggcaagacgacg
acggtcgtcggcgtgatcgcgtgcctgctcgatgcgcatccggagttgcggatcgcgctt
gccgcgcccaccggcaaggccgcgcagcggatgcaggaggcgctgcacgcgcgcgccggc
agcctgccggcggaactcgcggcgcgcctgccgcgcacgtcctgcacgctgcaccggctg
ctgggcggtggcccgggcgggcgcttcgcgcaccaccgcgacaatccgctgccgtacgat
ctcgtcgtcgtcgacgaggcttcgatgatcgacgtcgcgctcgccgcgcatttgctcgac
gcgctcgcgccgaacgcgcgcctcgtgctgctcggcgacaaggatcagctcgcggccgtc
gaggcgggcgcggtgttcgccgagctgagcgcgcgtcccgcgttcagcccggcgacgtgc
gcgacgatcgcgcgcgcgctcggcgtcggcgaggccgagttcgtggcggcgctgccggac
gggttcgtcgtgcaggcggtcggcgcggagcgcgtggcggacgcgcgtgcggcggcggcc
gatatggacgtggccgcgcgcgggacggccggcgccgcggctgcggccgcacgagcgacc
gcggccgcagccgcacgaatgaccacggccgcagccgcggcgagggggggcgcgccggaa
tccgccgcgcaacgcgcgccggcgccgcacgcgggccggcgcggcggcgggcgcgcatcg
aatcggaccgtcgacgatgcgcagggatcgttgttcgcgttcgacgacgacgcattcggt
gtgggcacgtcgggcggcgagccgggggccggcgcgcaaggtgccgggaggcgagatggc
ggggcgccgagcctcgacgagccgcacgccgggcgccgggacggcggcgcatcgcccggc
gtcgcgcacagccggcgcgatgcgttcgacgcgcgtgcccggtcgggtccggcggatgtt
tccgacctggaaaacgccgcgcgcgcgtacgcgccggcgggcgcagccggcccggccgat
tcgccggcggacgcgtctttcgtcgagccggccgcgtggatcgaagcggacgaactcgcg
tggctcgacaacgcggtcttttcgttctccgaaggcgcttcggcgaatgccgaagccgac
gggcggcgaagcgccgcggcgacggcgaccgacgcgggcgcgcgcaccgcgccgccggtt
gcgcgggaagcgacggcgccgacgccgcgcgagaccgcgcgatcggacggttccgccgtc
gcgccgctgaccgactgcgtcgtctggcttgaacgcaactatcgcttcggccttgattcg
ccgatcggccggctgtcgcttgcgattcgccgcggcgcggtgcaggacgcgctcgacgcg
ctatcgacgcaagacgacgcggccgcgcgttttagcgacgacggcggtgcgacgctatcg
gccgcgacggtcgagcagctcgcgcgaggcttcgccggctatgcggccgcgctgcgcgac
gcgctggcgacgcccgagcccgatgcgctgccgctcttcgacgtgctcaaccgctttcgc
gtgctttgcgcgacgcgcacgggcgcgcgcggcgcggaggaagtcaacgcgcgcatggcg
gccgaggtgcgccgcgcggtgcgcgtgccgctcgcgctcggtgcgcactggttcgccgga
cggcccgtgatggtgacgcgcaacgattacgcgctcggcctcttcaacggcgacatcggc
attgcgctgcccggcgcgcgcggtgcgctgcgcgtctggtttcgcggcgcggacggccgc
gcccgggcggtgtcgcccgccgcgctgccgccgcacgacacggcgttcgcgctgaccgtc
cacaaatcgcagggctcggaattcgacgacgcggcactgatcctgcccgcgtcgttcaat
cgcgtgctgtcgcgcgaactcgtctacaccgcgatcacgcgcgcgcgcgcgcgcgtgcag
gtgatcggctcgcgcgcggtgctcgcgctcgcgatcgcgacgcgcacggcgcgcgattcc
ggccttgccgcacgaatcgccgatgcgctgcgcgcgcggcaggagggcgcgcgatga

DBGET integrated database retrieval system