KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_1695Help
Entry
BURPS1710b_1695   CDS       T00289                                 

Definition
hypothetical protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
bpm  Burkholderia pseudomallei 1710b
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1817992..1818483
Genome map
AA seq 163 aa AA seqDB search
MAEKKTLIGVVGAATAALLLSIIPAFEGEVLVARPDPIGIVTACNGDTKDVYAGQRFTRD
ECRARLEQRLIEHAEPVLTCTPGLRGRTYQLAAAVSFAYNIGPRAYCGSTTARRFNAGDW
RGACRAINESDNGRPQWVTAGGRVLPGLVKRRATERAICERGL
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaagaagacgctgattggagtggtaggggccgcgacagcggcccttttgctt
tctatcattcctgcatttgaaggtgaggtgcttgtcgcgcggccagatccaatcggcatc
gtcacggcatgcaacggcgatacgaaagacgtgtacgcgggccagcgcttcacgcgtgat
gaatgccgcgcgcggctcgagcaacggctcatcgagcacgcggagccggtcctgacgtgc
acgcccggcttgagggggcgcacatatcagctcgcggcggcggtgagcttcgcctacaac
atcgggccgcgcgcctactgcggcagcacaacggcgaggcggttcaatgcgggcgactgg
cggggcgcgtgtcgcgcgatcaacgagtcggacaacggtcggccgcagtgggtgactgct
ggcggtcgagtgctgccgggtctcgtgaaacgccgcgctactgaacgcgcaatttgtgag
cgggggctgtga

DBGET integrated database retrieval system