KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_1709Help
Entry
BURPS1710b_1709   CDS       T00289                                 

Gene name
acsA
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm00010  Glycolysis / Gluconeogenesis
bpm00620  Pyruvate metabolism
bpm00640  Propanoate metabolism
bpm00680  Methane metabolism
bpm01100  Metabolic pathways
bpm01110  Biosynthesis of secondary metabolites
bpm01120  Microbial metabolism in diverse environments
bpm01130  Biosynthesis of antibiotics
bpm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BURPS1710b_1709 (acsA)
   00620 Pyruvate metabolism
    BURPS1710b_1709 (acsA)
   00640 Propanoate metabolism
    BURPS1710b_1709 (acsA)
  Energy metabolism
   00680 Methane metabolism
    BURPS1710b_1709 (acsA)
Enzymes [BR:bpm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BURPS1710b_1709 (acsA)
Lipid biosynthesis proteins [BR:bpm01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BURPS1710b_1709 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ABA50781
UniProt: Q3JTJ2
Position
I:complement(1830106..1831731)
Genome map
AA seq 541 aa AA seqDB search
MLPHAAHYAELVERFAWRVPAHYNIGVDACDKWADGSGRLALIHEHAHGVVARYTFDELR
SSSNRLANSFARAGVKRGDRIGILLAQGPETAIAHLAAYKLGAIAVPLFTLFGADALEFR
LGDSGAVALVTDRAGYEKIAPLHASLPSLATIYCIDGAPDLAEPGVLAFDAALAAESDTF
RPADTSADDPALIIYTSGTTGKPKGALHAHRVLLGHLPGVEMSQNLFPARARLFWTPADW
AWIGGLLDVLLPSLHHGVPVLARRFEKFGGAAAFDLLARHGVTHAFLPPTALKLMRAAVA
RPRERYALALESVASGGESLGAELVSWGRDAFGVTINEFYGQTECNVVLSSCSALFEPRA
GTIGKAAPGHRVAIVDDAGNALPPGVTGNIGVRAPDPVMFIGYWRRPEATREKFAGDFLL
TGDLGIADADGFIRFVGRNDDVITSAGYRIGPGPIEDCLLEHPAVRMAAVVGVPDAVRTE
IVKAFVVLNAGYEGSAALARELQTHVKTRLAAHEYPRALAFVDSLPMTATGKIIRRALRD
I
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgctgccccacgccgcccattacgccgagctcgtcgagcgcttcgcctggcgggttccc
gcgcactacaacatcggcgtcgacgcgtgcgacaaatgggccgatggcagcggccgcctc
gcactgatccacgaacacgcgcacggcgtcgtcgcacgttacacgttcgacgaactgagg
agcagctctaatcgactcgcgaacagcttcgcgcgcgcaggcgtgaagcgcggcgaccgc
atcggcatcctcctcgcgcaaggcccggaaacggcgatcgcccatctggccgcatacaag
ctcggcgcgatcgcggtgccgctcttcacactcttcggcgcggacgcgctcgaattccgc
ctcggcgatagcggcgccgtcgcgctcgtcaccgatcgcgccggttacgagaaaatcgcg
ccgctgcatgcgtcgctgccgtcgctcgcgacgatctactgcatcgacggcgcgcccgat
ctcgccgagcccggcgtgctcgcgttcgatgcggcgctcgcggccgaatcggacacgttc
cggcctgcggacacgtcggccgacgatccggcgctcatcatctacacgtccggcacgacg
ggcaaaccaaagggcgcgctgcacgcgcatcgggtgctgctcggccatctgcccggcgtc
gagatgtcgcagaacctgtttccggcgcgtgcgcgcctgttctggacgcccgccgattgg
gcatggatcggcgggctgctcgacgtcctgctgccgtcgctgcaccacggcgtgccggtc
ctcgcgcgacgcttcgagaaattcggcggcgcggccgcgttcgatctgctcgcccggcac
ggcgtgacgcacgcgttcctgccgccgaccgcgctgaagctgatgcgcgcggctgtcgcg
cggccgcgtgaacgttacgcgctcgcgctcgaatcggtagcgagcggcggcgaatcgctc
ggcgccgaactcgtttcctggggccgcgacgcgttcggcgtgacgatcaacgagttctac
ggacagaccgaatgcaacgtcgtgctgtcgtcgtgcagcgcgctgttcgagccgcgcgcg
gggacgatcggcaaggcggcgcccgggcatcgcgtcgcgatcgtcgacgatgccggcaac
gcgctgccgcccggcgtcacgggcaacatcggcgtgcgcgcgcccgaccccgtgatgttc
atcggctactggcgcaggcccgaggcgacgcgcgagaagttcgccggcgacttcctgctg
acgggcgacctcggcatcgccgacgccgacggtttcatccgcttcgtcggccgcaacgac
gacgtgatcacgagcgccggctaccggatcggcccgggaccgatcgaggattgcctgctc
gagcatccggcggtgcggatggcggccgtcgtcggcgtgccggacgcggtccgcaccgaa
atcgtcaaggcgttcgtcgtgctgaacgccggctatgaaggaagcgccgcgctcgcccgc
gagctgcaaacgcacgtgaagacacggctcgccgcacacgaatatccgcgtgcgctcgcc
ttcgtcgacagcctgccgatgaccgcgaccggcaagatcatccgccgcgcgctgcgcgac
atctga

DBGET integrated database retrieval system