KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_1709Help
Entry
BURPS1710b_1709   CDS       T00289                                 

Gene name
acsA
Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bpm01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bpm00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bpm00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bpm00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:bpm00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1830106..1831731)
Genome map
AA seq 541 aa AA seqDB search
MLPHAAHYAELVERFAWRVPAHYNIGVDACDKWADGSGRLALIHEHAHGVVARYTFDELR
SSSNRLANSFARAGVKRGDRIGILLAQGPETAIAHLAAYKLGAIAVPLFTLFGADALEFR
LGDSGAVALVTDRAGYEKIAPLHASLPSLATIYCIDGAPDLAEPGVLAFDAALAAESDTF
RPADTSADDPALIIYTSGTTGKPKGALHAHRVLLGHLPGVEMSQNLFPARARLFWTPADW
AWIGGLLDVLLPSLHHGVPVLARRFEKFGGAAAFDLLARHGVTHAFLPPTALKLMRAAVA
RPRERYALALESVASGGESLGAELVSWGRDAFGVTINEFYGQTECNVVLSSCSALFEPRA
GTIGKAAPGHRVAIVDDAGNALPPGVTGNIGVRAPDPVMFIGYWRRPEATREKFAGDFLL
TGDLGIADADGFIRFVGRNDDVITSAGYRIGPGPIEDCLLEHPAVRMAAVVGVPDAVRTE
IVKAFVVLNAGYEGSAALARELQTHVKTRLAAHEYPRALAFVDSLPMTATGKIIRRALRD
I
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgctgccccacgccgcccattacgccgagctcgtcgagcgcttcgcctggcgggttccc
gcgcactacaacatcggcgtcgacgcgtgcgacaaatgggccgatggcagcggccgcctc
gcactgatccacgaacacgcgcacggcgtcgtcgcacgttacacgttcgacgaactgagg
agcagctctaatcgactcgcgaacagcttcgcgcgcgcaggcgtgaagcgcggcgaccgc
atcggcatcctcctcgcgcaaggcccggaaacggcgatcgcccatctggccgcatacaag
ctcggcgcgatcgcggtgccgctcttcacactcttcggcgcggacgcgctcgaattccgc
ctcggcgatagcggcgccgtcgcgctcgtcaccgatcgcgccggttacgagaaaatcgcg
ccgctgcatgcgtcgctgccgtcgctcgcgacgatctactgcatcgacggcgcgcccgat
ctcgccgagcccggcgtgctcgcgttcgatgcggcgctcgcggccgaatcggacacgttc
cggcctgcggacacgtcggccgacgatccggcgctcatcatctacacgtccggcacgacg
ggcaaaccaaagggcgcgctgcacgcgcatcgggtgctgctcggccatctgcccggcgtc
gagatgtcgcagaacctgtttccggcgcgtgcgcgcctgttctggacgcccgccgattgg
gcatggatcggcgggctgctcgacgtcctgctgccgtcgctgcaccacggcgtgccggtc
ctcgcgcgacgcttcgagaaattcggcggcgcggccgcgttcgatctgctcgcccggcac
ggcgtgacgcacgcgttcctgccgccgaccgcgctgaagctgatgcgcgcggctgtcgcg
cggccgcgtgaacgttacgcgctcgcgctcgaatcggtagcgagcggcggcgaatcgctc
ggcgccgaactcgtttcctggggccgcgacgcgttcggcgtgacgatcaacgagttctac
ggacagaccgaatgcaacgtcgtgctgtcgtcgtgcagcgcgctgttcgagccgcgcgcg
gggacgatcggcaaggcggcgcccgggcatcgcgtcgcgatcgtcgacgatgccggcaac
gcgctgccgcccggcgtcacgggcaacatcggcgtgcgcgcgcccgaccccgtgatgttc
atcggctactggcgcaggcccgaggcgacgcgcgagaagttcgccggcgacttcctgctg
acgggcgacctcggcatcgccgacgccgacggtttcatccgcttcgtcggccgcaacgac
gacgtgatcacgagcgccggctaccggatcggcccgggaccgatcgaggattgcctgctc
gagcatccggcggtgcggatggcggccgtcgtcggcgtgccggacgcggtccgcaccgaa
atcgtcaaggcgttcgtcgtgctgaacgccggctatgaaggaagcgccgcgctcgcccgc
gagctgcaaacgcacgtgaagacacggctcgccgcacacgaatatccgcgtgcgctcgcc
ttcgtcgacagcctgccgatgaccgcgaccggcaagatcatccgccgcgcgctgcgcgac
atctga

DBGET integrated database retrieval system