KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_1734Help
Entry
BURPS1710b_1734   CDS       T00289                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bpm00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(1867123..1869465)
Genome map
AA seq 780 aa AA seqDB search
MHCLAQRERERRRAARPRRRREAHAGREARERRERPGRRAMTADPRHPSIVELADAAGLD
AHWIDASGFARRVGDDMLAALLDALGYPCDTRAARAESAARLAAHAQAAPRLVTGDVDAP
LTLPASLGRPGACYRVTLENGDAVAGRFAQPAGAAVLPPLATPGYHVLDTGEQRATLAIA
PPSAWTPADAMRAAAAGGRERPPPWGLAAQLYGLRREADGGIGDFTALAACARAAARRGA
HALAISPTQAAFPALPEHDSPYSPSSRLWRNAAYIDVETVLGAHAARAAIADAGLGAQWS
ALTRAPLVDWPGAVPAKLRVLRLLFDRWRAQAPTGADAGPRAFARFRARHAGALDAHATF
DALQACCIDNGIGADWRRWPPAWRTPDAPDVAAFARAHAHDIAFYAFLQWQAARGLAAAQ
RAARGRGMAIGLIADLPVGCDAAGSDAWRDGDAMLRGLSIGAPADPFNARGQAWGVTTWT
PTALRARGFAPFVECLRAGFAHAGGVRIDHVLGLARLWVVRDGAPPRDGAYLRYPRDDLL
RLAALESFRHRAIVIGEDLGTVPADFRARIAARGIVGLRALWFERDPAGAFRAPGDWDRH
AAATSSTHDLPTVAGWWRGVDLGWRWRAAASASACAPASSLSPASDAEAEANAPPARPGE
SEVAGPDALPPEVRDMRRAERAALWRALQQAGVAARGQKMPPRDAPPVGAILAYVAQAPA
PLAIFPLEDLLALEGQPNVPGPPCGHPNWRRRMPRSVDALFDAPARTRIAAVRRARKRAR
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
gtgcattgcctggcgcagcgggaacgtgaacggcgtcgcgcggcgcggccgcgccgtcga
cgcgaagcacatgccggccgtgaagcacgcgaacggcgtgaacggccaggacggcgcgcc
atgaccgccgatccgcgtcatccgtcgatcgtcgagctcgcggacgcggccgggctcgac
gcgcactggatcgacgcatcgggcttcgcgcggcgggtcggcgacgacatgctcgcggcg
ttgctcgacgcgctcggctacccgtgcgacacgcgcgcggcgcgcgccgagagcgccgcg
cggctcgcggcgcacgcgcaggccgcgccgcggctcgtgacgggcgacgtcgacgcgccg
ctcacgctgcccgcctcgctcggacgccccggcgcgtgctaccgggtcaccctcgaaaac
ggcgacgccgtcgccggccgcttcgcgcagcccgccggcgcagccgtgctgccgccgctc
gcgacgcccggctaccacgtgctcgacaccggcgagcagcgcgcaacactcgccatcgcg
ccgccatccgcatggacgcccgccgacgcgatgcgcgccgcggcggccggcggccgcgaa
cgcccgccgccgtggggcctcgcggcgcaactctacgggctgcgccgcgaggccgacggc
ggcatcggcgatttcaccgcgcttgccgcctgcgcgcgcgccgccgcccggcgcggcgcg
cacgcgctcgcgatcagcccgacgcaggcggccttccccgcgctgcccgagcatgacagc
ccgtactcgccttcgtcgcggctttggcgcaacgccgcctacatcgacgtcgaaacggtg
ctcggcgcgcacgcggcgcgcgcggcgatcgccgatgcggggctcggcgcgcaatggagc
gcgctcacgcgcgcgccgctcgtcgattggcccggcgcggtgccggcgaagctgcgcgtg
ctgcgcctgctgttcgaccgctggcgcgcgcaggcgcccacgggcgcggatgcgggcccg
cgggcgttcgcgcgctttcgggcacggcacgccggcgcgctcgacgcacatgcgacgttc
gacgcgttgcaggcgtgctgcatcgacaacggcatcggcgcggactggcggcgttggccg
cccgcatggcgcacgcccgatgcgccggacgtcgccgcgttcgcgcgcgcgcacgcgcac
gacatcgcgttctatgccttcctgcaatggcaggccgcgcgcgggctcgcggccgcgcaa
cgcgccgcgcgcggccgcggcatggcgatcggcctgatcgcggacttgccggtcggctgc
gacgcggcgggcagcgacgcgtggcgggatggcgatgcgatgctgcgcggcctgtcgatc
ggcgcgcccgccgatccgttcaacgcgcgcggccaggcatggggcgtcaccacatggacg
ccgacggcgctgcgcgcgcggggcttcgcgccgttcgtcgaatgtctgcgcgcgggcttc
gcgcacgcgggaggcgttcgcatcgatcacgtgctcggcctcgcgcggctgtgggtggtg
cgcgacggcgcgccgccgcgcgacggcgcgtacctgcgctatccgcgcgacgatttgctg
cggctcgccgcgctcgaatcgttccggcatcgcgcgatcgtcatcggcgaggatctcggc
accgtgccggcggatttccgcgcgcggatcgccgcgcgcggcatcgtcggcctgcgcgcg
ctctggttcgaacgggacccggcgggcgcgttccgcgcgccgggcgattgggatcgtcac
gcggccgcaacgagctcgacgcacgatctgccgacggtcgcgggctggtggcgcggcgtc
gatctcggctggcgatggcgcgcggccgcctccgcctcggcctgcgcgcccgcgtcctcc
ctctctcccgcctccgacgccgaggccgaggcgaacgccccgcccgcgcggcccggcgaa
tcggaggtcgccgggccggatgcgctgccgcccgaggtgcgcgacatgcgccgcgccgag
cgcgcggcgctctggcgcgcgctgcagcaagccggcgtcgccgcgcgcgggcaaaagatg
ccgccgcgggatgcgccccccgtcggtgcgatactcgcgtacgtcgcgcaagcgcccgcg
ccgctcgcgatctttccgctcgaggatctgctcgcgctcgagggtcagccgaacgtgccg
ggcccgccgtgcgggcacccgaactggcggcggcgcatgccgcgctccgtcgacgcgctg
ttcgacgcgccggcgcgcacgcgcatcgccgccgtgcggcgcgcgaggaagcgcgcgcga
tga

DBGET integrated database retrieval system