KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_1805Help
Entry
BURPS1710b_1805   CDS       T00289                                 

Definition
di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bpm  Burkholderia pseudomallei 1710b
Brite
Enzymes [BR:bpm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     BURPS1710b_1805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1968251..1969654
Genome map
AA seq 467 aa AA seqDB search
MRRLPRYARQHRSFFVAPRAFAAAAALAAGVAACDANGPGASAAAAVAPAALAVPAASAA
SAARPAPLAQPAAPAVVDSQPQTRAQVYEAVKQMTALGRQLFFDPSLSGSGKLACASCHS
PQHAFGPPNALPAQFGGDDLRQQGFRAVPTLKYLQKVPAFSEHYHESDDEGDESVDAGPT
GGLTWDGRVDSGAEQARAPLTSPFEMNGTPEKVARAVRAAPYAPAFRAAFGARVLDDDRA
TFEAVLQALGTFEQAPDVFYPYTSKYDAYLAGRARLTRAELHGLQVFNDEKKGNCASCHV
SRRGLDGSPPQFSDFGLIALGVPRNRALAVNRNPNFYDLGACGPERRDLKGRDEFCGLFR
TPTLRNVALKKTFFHNGVYHSLDDVLRFYAERDTHPEKFYPVKRGVVQKFDDLPKRYWKN
LNDEPPFERKRGDPPAMTDAEIRDVIAFLGTLTDGYDPRAKPAGGAR
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcttgccgcgatacgcccgccagcaccgttcgttcttcgtcgcgccgcgcgcg
ttcgcggcggccgccgcgcttgccgcgggcgtcgccgcgtgtgacgcgaacgggccgggc
gcgagcgccgccgcggccgtcgcgcccgctgcgctcgctgtcccagccgcctccgctgcc
tccgctgcgcgtcccgcgccgctcgcgcagccggccgcgcccgccgtcgtcgacagtcag
ccgcagacgcgcgcgcaggtgtacgaggcggtcaagcagatgacggcgctcggcaggcag
ttgttcttcgatccttcgctgtcgggcagcggcaagctcgcctgcgcgtcgtgccacagc
ccgcagcacgcgttcgggccgccgaacgcgctgcccgcgcaattcggcggcgacgatctg
cgccagcagggctttcgcgccgtgccgacgctcaaatacctgcagaaggtgcccgcgttc
agcgagcactatcacgaatcggacgacgagggcgacgagagcgtcgacgccggcccgacg
ggcgggctcacgtgggacggccgcgtggacagcggcgccgagcaggcgcgcgcgccgctc
acgtcgccgttcgagatgaacggcacgcccgagaaggtcgcgcgcgcggtgcgggccgcg
ccgtacgcgcccgcgtttcgcgcggcgttcggcgcgcgcgtgctcgacgacgaccgcgcg
acgttcgaggcggtgctgcaggcgctcggcacgttcgagcaggcgcccgacgtgttctat
ccgtacacgagcaagtacgacgcgtacctggcgggccgcgcgcggttgacgcgcgccgag
ctgcacgggctgcaggtcttcaacgacgagaagaagggcaactgcgcgagctgccacgtg
agccggcgcgggctcgacggctcgccgccgcagttcagcgatttcggcctgatcgcgctc
ggcgtgccgcgcaatcgcgcgctcgcggtgaatcggaatccgaatttttacgacctcggc
gcatgcgggcccgagcgccgggacctgaaggggcgcgacgagttctgcgggctgttccgc
acgccgacgctgcgtaacgtcgcgctgaagaagacgttcttccacaacggcgtctatcac
tcgctcgacgacgtgctgcgcttctacgccgagcgcgacacgcatccggagaagttctat
ccggtgaagcgcggcgtcgttcagaagttcgacgacttgccgaagcgctactggaagaac
ctgaacgacgagccgccgttcgagcgcaagcgcggcgatccgcccgcgatgaccgatgcg
gagatccgggacgtgatcgcgttcctcggcacgctcaccgacggctacgatccgcgcgcg
aagccggcaggcggcgcgcgctga

DBGET integrated database retrieval system