KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_1807Help
Entry
BURPS1710b_1807   CDS       T00289                                 

Gene name
cht60
Definition
protein YbbD (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BURPS1710b_1807 (cht60)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BURPS1710b_1807 (cht60)
Enzymes [BR:bpm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BURPS1710b_1807 (cht60)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1970686..1972785
Genome map
AA seq 699 aa AA seqDB search
MKRRECRGNARGKDSVKMRKKSLVHLPVALAVAAALGACSGDDDATLESRADAIVERMTT
RQKVGQKLMMAFRYWCPDGQPACTTGMTEFPDAARDALRENGIGGVILFSNNLTGIEQTR
RLIDGIRAAPAADSPLGLMIGIDEEGGNVFRLPRVEATAFAGNMALGAAYEATRDDRLAY
DMGRVLAAEIAAVGFNVNFAPDVDVNSNSLNPVINVRAFGDDPATIGLLGRRMVQGMKSE
RVIGTFKHFPGHGDTDTDSHYGLPVVIKSRADAYAIDLAPYRQAIEAGEAPDMIMTAHIQ
YPSLDDTRVATRTGEQMIAPATMSRRIQHDILRGEFGYQGVTITDALDMKGIAGFFDEDD
AVVKVFQADVDIALMPVEFRTAADAGRLAALVDRVAAAVDSGRIDRAEFDRSVRRIVLTK
LRHGIVASDRGRPVDELASIGGPAHRAIERDIAQKSITVLRNENGALPLQAAGRRIFILT
PWGEQAEAMRRRFVELGHPLVTGAKLSTITWAEQQQAIDAADVVIVGTLSTGVTPVEHNG
DPNARVSPPAPSAVRMRQAAPANGEEEGSVIFDHVERADAAKDIGARPSVLAAIAAPSEA
QQMRDAMDYAKARRKTVIHVTMRAPYDVISYDDVADATLATYAYYGYEGGLRGPSLPAAV
DAMLGVARPVGRLPVAIHALNADGSTGPLRYARGFGLQY
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgacgtgaatgccgcgggaatgcgcgcggcaaggattcggtgaagatgcgcaag
aaaagcttggttcatttgcccgtcgcgctggcggtggccgcggcgctcggcgcgtgctcg
ggcgacgacgacgcgacgctcgagtcgcgcgcggacgcgatcgtcgaacgcatgacgacc
cggcagaaggtcggccaaaaactgatgatggcgttccggtactggtgccccgacgggcag
cccgcgtgcacgaccggcatgaccgaatttccggacgccgcgcgcgacgcgctgcgcgag
aacggcattggcggcgtgatcctgttctcgaacaacctgacgggcatcgagcagacgcgc
cggctgatcgacggcattcgggccgcgcccgcggccgacagcccgctcgggctgatgatc
ggcatcgacgaggagggcggcaacgtgtttcgcctgccgcgcgtcgaggcgaccgcgttc
gccggcaacatggcgctcggcgcggcgtacgaagcgacgcgggacgaccggctcgcgtac
gacatgggccgcgtgctcgccgcggagatcgcggcggtcggcttcaacgtgaatttcgcg
ccggacgtcgacgtcaacagcaattcgctcaatccggtgatcaacgtgcgcgcgttcggc
gacgatccggcgacgatcggcctgctcggccggcgcatggtgcagggcatgaagagcgag
cgcgtgatcggcacgttcaagcattttcccgggcacggcgacacggataccgattcgcac
tacggactgcccgtcgtgatcaagtcgcgcgccgacgcctacgcgatcgatctcgcgccg
taccggcaggcgatcgaagcgggcgaggcgcccgacatgatcatgaccgcgcacatccag
tatccgtcgctcgacgacacccgcgtcgcgacccgcacgggcgagcagatgatcgcgccc
gcgacgatgtcgcggcgcatccagcacgatatcctgcgcggcgagttcggctatcagggc
gtgacgatcaccgacgcgctcgacatgaagggcatcgccggcttcttcgacgaggacgac
gcggtcgtcaaggtgttccaggcggacgtcgacattgcgctgatgcccgtcgagtttcgc
accgcggccgatgccgggcgcctggcggcgctcgtcgatcgcgtcgccgcggcggtcgat
tcggggcggatcgatcgcgccgagttcgatcgctcggtgcgccgtatcgtgctgacgaag
ctgcgccacggcatcgtcgcgtcggatcgcggccggccggtcgacgagctggcatcgatc
ggcgggcccgcgcaccgcgcgatcgagcgcgacatcgcgcaaaaatcgatcaccgtgctg
cgcaacgagaacggcgcgctgccgctgcaggccgcgggccggcgcatcttcatcctgacg
ccgtggggcgagcaggccgaggcgatgcggcggcgtttcgtcgagcttggccatccgctc
gtcacgggcgcgaagctgagcacgatcacgtgggccgaacagcagcaggcgatcgatgcg
gccgacgtcgtgatcgtcggcacgctgtcgacgggcgtcacccccgtcgagcacaacggg
gatccgaacgcgcgcgtgagcccgccggcgccgtcggccgtgcggatgcggcaggccgcg
cccgcgaacggcgaggaggagggttcggtgatcttcgaccacgtcgagcgggcggacgcg
gcgaaggacatcggcgcgcgcccgagcgtgctcgcggcgatcgcggcgccgagcgaggcg
cagcagatgcgcgacgcgatggactacgcgaaggcgcggcgcaagaccgtgatccacgtg
acgatgcgcgcgccgtacgacgtgatcagctacgacgatgtcgcggacgcgacgctcgcc
acctacgcgtactacggttacgaaggcggcttgcgcggcccgtcgctgcccgcggccgtc
gacgcgatgctcggcgtcgcgcggccggtcggcaggctgccggtcgcgatccacgcactg
aacgcggacggatcgacggggccgctgcgctacgcgcgcggattcgggttgcagtactga

DBGET integrated database retrieval system