KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_1807Help
Entry
BURPS1710b_1807   CDS       T00289                                 

Gene name
cht60
Definition
protein YbbD (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bpm00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bpm00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1970686..1972785
Genome map
AA seq 699 aa AA seqDB search
MKRRECRGNARGKDSVKMRKKSLVHLPVALAVAAALGACSGDDDATLESRADAIVERMTT
RQKVGQKLMMAFRYWCPDGQPACTTGMTEFPDAARDALRENGIGGVILFSNNLTGIEQTR
RLIDGIRAAPAADSPLGLMIGIDEEGGNVFRLPRVEATAFAGNMALGAAYEATRDDRLAY
DMGRVLAAEIAAVGFNVNFAPDVDVNSNSLNPVINVRAFGDDPATIGLLGRRMVQGMKSE
RVIGTFKHFPGHGDTDTDSHYGLPVVIKSRADAYAIDLAPYRQAIEAGEAPDMIMTAHIQ
YPSLDDTRVATRTGEQMIAPATMSRRIQHDILRGEFGYQGVTITDALDMKGIAGFFDEDD
AVVKVFQADVDIALMPVEFRTAADAGRLAALVDRVAAAVDSGRIDRAEFDRSVRRIVLTK
LRHGIVASDRGRPVDELASIGGPAHRAIERDIAQKSITVLRNENGALPLQAAGRRIFILT
PWGEQAEAMRRRFVELGHPLVTGAKLSTITWAEQQQAIDAADVVIVGTLSTGVTPVEHNG
DPNARVSPPAPSAVRMRQAAPANGEEEGSVIFDHVERADAAKDIGARPSVLAAIAAPSEA
QQMRDAMDYAKARRKTVIHVTMRAPYDVISYDDVADATLATYAYYGYEGGLRGPSLPAAV
DAMLGVARPVGRLPVAIHALNADGSTGPLRYARGFGLQY
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgacgtgaatgccgcgggaatgcgcgcggcaaggattcggtgaagatgcgcaag
aaaagcttggttcatttgcccgtcgcgctggcggtggccgcggcgctcggcgcgtgctcg
ggcgacgacgacgcgacgctcgagtcgcgcgcggacgcgatcgtcgaacgcatgacgacc
cggcagaaggtcggccaaaaactgatgatggcgttccggtactggtgccccgacgggcag
cccgcgtgcacgaccggcatgaccgaatttccggacgccgcgcgcgacgcgctgcgcgag
aacggcattggcggcgtgatcctgttctcgaacaacctgacgggcatcgagcagacgcgc
cggctgatcgacggcattcgggccgcgcccgcggccgacagcccgctcgggctgatgatc
ggcatcgacgaggagggcggcaacgtgtttcgcctgccgcgcgtcgaggcgaccgcgttc
gccggcaacatggcgctcggcgcggcgtacgaagcgacgcgggacgaccggctcgcgtac
gacatgggccgcgtgctcgccgcggagatcgcggcggtcggcttcaacgtgaatttcgcg
ccggacgtcgacgtcaacagcaattcgctcaatccggtgatcaacgtgcgcgcgttcggc
gacgatccggcgacgatcggcctgctcggccggcgcatggtgcagggcatgaagagcgag
cgcgtgatcggcacgttcaagcattttcccgggcacggcgacacggataccgattcgcac
tacggactgcccgtcgtgatcaagtcgcgcgccgacgcctacgcgatcgatctcgcgccg
taccggcaggcgatcgaagcgggcgaggcgcccgacatgatcatgaccgcgcacatccag
tatccgtcgctcgacgacacccgcgtcgcgacccgcacgggcgagcagatgatcgcgccc
gcgacgatgtcgcggcgcatccagcacgatatcctgcgcggcgagttcggctatcagggc
gtgacgatcaccgacgcgctcgacatgaagggcatcgccggcttcttcgacgaggacgac
gcggtcgtcaaggtgttccaggcggacgtcgacattgcgctgatgcccgtcgagtttcgc
accgcggccgatgccgggcgcctggcggcgctcgtcgatcgcgtcgccgcggcggtcgat
tcggggcggatcgatcgcgccgagttcgatcgctcggtgcgccgtatcgtgctgacgaag
ctgcgccacggcatcgtcgcgtcggatcgcggccggccggtcgacgagctggcatcgatc
ggcgggcccgcgcaccgcgcgatcgagcgcgacatcgcgcaaaaatcgatcaccgtgctg
cgcaacgagaacggcgcgctgccgctgcaggccgcgggccggcgcatcttcatcctgacg
ccgtggggcgagcaggccgaggcgatgcggcggcgtttcgtcgagcttggccatccgctc
gtcacgggcgcgaagctgagcacgatcacgtgggccgaacagcagcaggcgatcgatgcg
gccgacgtcgtgatcgtcggcacgctgtcgacgggcgtcacccccgtcgagcacaacggg
gatccgaacgcgcgcgtgagcccgccggcgccgtcggccgtgcggatgcggcaggccgcg
cccgcgaacggcgaggaggagggttcggtgatcttcgaccacgtcgagcgggcggacgcg
gcgaaggacatcggcgcgcgcccgagcgtgctcgcggcgatcgcggcgccgagcgaggcg
cagcagatgcgcgacgcgatggactacgcgaaggcgcggcgcaagaccgtgatccacgtg
acgatgcgcgcgccgtacgacgtgatcagctacgacgatgtcgcggacgcgacgctcgcc
acctacgcgtactacggttacgaaggcggcttgcgcggcccgtcgctgcccgcggccgtc
gacgcgatgctcggcgtcgcgcggccggtcggcaggctgccggtcgcgatccacgcactg
aacgcggacggatcgacggggccgctgcgctacgcgcgcggattcgggttgcagtactga

DBGET integrated database retrieval system