KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_2596Help
Entry
BURPS1710b_2596   CDS       T00289                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bpm01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bpm00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2877843..2878994
Genome map
AA seq 383 aa AA seqDB search
MVRNMSATLALTEQLIARASVTPDDQHCQQLMIERLAALGFECETIASHGVTNFWAVKRG
TAGRAGKLLAFAGHTDVVPTGPLEQWRSPPFVPTHRDGKLYGRGAADMKTSLAGFVVAAE
EFVAAHPQHRGSIGFLITSDEEGPATDGTVKVVEALAARGERLDYCIVGEPTSTATLGDV
VKNGRRGSMSGELVVKGVQGHIAYPHLAKNPIHLLAPALAELAAEQWDEGNEYFPPTTWQ
VSNLRAGTGATNVIPGHADLLFNFRFSTASTVEGLQARVHAILDRHGLDYTLNWSVSGLP
FLTPRGELSNALDAAIRAETGVSPELSTTGGTSDGRFIARICPQVIEFGPPNASIHKIDE
HIDVRFVDPLKNVYRRVLEQLIA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtggtccgaaacatgtccgccacccttgccctcaccgaacagttgatcgcgcgcgcgtcc
gtcacgcccgacgatcagcactgccagcaattgatgatcgagcgcctcgccgccctcggc
ttcgagtgcgaaacgatcgcgtcgcacggcgtgacgaacttctgggccgtcaagcgcggc
acggccggccgcgcaggcaagctgctcgcgttcgcgggccataccgacgtcgtgccgacc
ggcccgctcgagcagtggcgctcgccgccgttcgtgccgacgcaccgcgacggcaagctg
tacggccgcggcgcggccgacatgaaaacctcgctcgcgggcttcgtcgtcgcggccgag
gagttcgtcgccgcgcatccgcagcaccgcggctcgatcggtttcctgatcacgagcgac
gaggaaggcccggccaccgacggcaccgtgaaagtcgtcgaggcgctcgccgcgcgcggc
gagcgcctcgattactgcatcgtcggcgaaccgacctcgacggcgacgctcggcgacgtc
gtgaagaacggccggcgcggctcgatgtcgggcgagctcgtcgtcaagggcgtgcaaggc
catatcgcgtatccgcatctcgcgaagaacccgatccatctgctcgcgccggcgctcgcc
gagctcgccgccgagcaatgggacgaaggcaacgagtactttccgccgaccacctggcag
gtgtcgaacctgcgcgcgggcaccggcgcgacgaacgtgattccgggccacgccgatctg
ctgttcaacttccgcttctcgacggcgagcacggtcgagggcctgcaggcgcgcgtgcac
gcgatcctcgacaggcacgggctcgattacacgctgaactggtcggtgagcggcctgccg
ttcctcacgccgcgcggcgagctgtcgaacgcgctcgacgccgcgatccgcgcggaaacg
ggcgtctcgcccgagctgtcgacgacgggcggcacgtccgacggccgcttcatcgcgcgc
atctgcccgcaggtgatcgagttcggcccgccgaacgcgagcatccacaagatcgacgag
cacatcgacgtgcgcttcgtcgacccgctgaagaacgtgtaccgccgcgtgctcgaacaa
ctgatcgcctga

DBGET integrated database retrieval system