KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_2613Help
Entry
BURPS1710b_2613   CDS       T00289                                 

Gene name
aceA
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:bpm01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:bpm00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
I:2896631..2897938
Genome map
AA seq 435 aa AA seqDB search
MSRQQQAQELQKQWETDPRWKGIKRAFTAEDVVRLRGSIQQEHTLAKRGAEKLWTLINNE
PFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAGDANVAGEMYPDQSLYPANSVPLVVKR
INNTLTRADQIQWSEGKNPGDEGYVDFFAPIVADAEAGFGGVLNAFELMKAMIEAGASGV
HFEDQLASVKKCGHMGGKVLVPTREAVAKLTAARLAADVMGTPTVLVARTDAEAADLITS
DIDDNDKPYLTGERTVEGFFRTKPGLEQAISRGLAYAPYADLIWCETGKPDLEYAKKFAE
AIHKQFPGKLLSYNCSPSFNWKKNLDDATIAKFQKELGAMGYKFQFITLAGFHALNYSMF
NLAHGYARTQMSAFVELQQAEFAAADKGFTAVKHQREVGTGYFDAVTQTVEREASTTALH
GSTEDEQFFDGQKVA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgtcaacaacaggctcaggaactgcaaaagcaatgggaaaccgacccgcgctgg
aagggcatcaagcgcgcgttcaccgctgaggacgtcgtgcgcctgcgcggctcgatccag
caagagcacacgctcgcgaagcgcggcgcggaaaagctctggacgctcatcaacaacgag
ccgttcgtcaacgcactcggcgcgctgacgggcaaccaggcgatgcagcaggtcaaggcc
ggcctcaaggcgatctatctgtcgggctggcaagtcgcgggcgacgcgaacgtcgcgggc
gaaatgtatccggaccagtcgctgtacccggcgaactcggtgccgctcgtcgtcaagcgc
atcaacaacacgctcacgcgcgccgatcagatccagtggtcggaaggcaagaaccccggc
gacgaaggctatgtcgacttcttcgcgccgatcgtcgccgacgcggaagccggcttcggc
ggcgtgctgaacgcgttcgaactgatgaaggcgatgatcgaggcgggcgcgtcgggcgtt
cacttcgaagaccagctcgcctcggtcaagaagtgcggccacatgggcggcaaggtgctc
gtgccgacccgcgaggcggtcgcgaagctgacggccgcgcgtctcgccgccgacgtgatg
ggcacgccgaccgtgctggtcgcgcgcaccgacgccgaagcggccgacctgatcacgtcc
gacatcgacgacaacgacaagccgtacctgacgggcgagcgcacggtcgaaggcttcttc
cgcacgaagccgggcctcgagcaggctatctcgcgcggcctcgcctatgcgccgtacgcc
gacctgatctggtgcgaaaccggcaagccggatctcgaatacgcgaagaagttcgcggaa
gcgatccacaagcagttcccgggcaagctgctgtcgtacaactgctcgccgtcgttcaac
tggaagaagaacctcgacgacgcgacgatcgcgaagttccagaaggaactcggcgcgatg
ggctacaagttccagttcatcacgctcgccggcttccatgcgctgaactactcgatgttc
aacctcgcgcacggctacgcccgcacgcagatgagcgcgttcgtcgaactgcagcaagcc
gagttcgcggcggccgacaagggcttcaccgcggtcaagcaccagcgtgaagtcggcacc
ggctacttcgacgcggtgacgcagacggtcgagcgcgaagcgtcgacgaccgcgctgcac
ggctcgaccgaagacgaacagttcttcgacggccagaaagtcgcctga

DBGET integrated database retrieval system