KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_2744Help
Entry
BURPS1710b_2744   CDS       T00289                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm00010  Glycolysis / Gluconeogenesis
bpm00020  Citrate cycle (TCA cycle)
bpm00620  Pyruvate metabolism
bpm01100  Metabolic pathways
bpm01110  Biosynthesis of secondary metabolites
bpm01120  Microbial metabolism in diverse environments
bpm01130  Biosynthesis of antibiotics
bpm01200  Carbon metabolism
Module
bpm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BURPS1710b_2744 (aceF)
   00020 Citrate cycle (TCA cycle)
    BURPS1710b_2744 (aceF)
   00620 Pyruvate metabolism
    BURPS1710b_2744 (aceF)
Enzymes [BR:bpm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BURPS1710b_2744 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_D23 NQRA
Motif
Other DBs
NCBI-ProteinID: ABA47929
UniProt: Q3JQM3
Position
I:complement(3038830..3040473)
Genome map
AA seq 547 aa AA seqDB search
MSQAIEVKVPDIGDYKDVPVIEVLVKPGDAVEPEQSLVTLESDKATMDVPSPSAGTVKEV
KVKVGDAVSQGSLIVLLDGAQAAAQPAQANGAATSAAQPAAAPAAAPAPAAAAGGGTVDV
KVPDIGDYKDVPVIEIAVKIGDTVEKEQSLVTLESDKATMDVPSPAAGVVKDIKVKVGDA
VSEGSLIVVLEASGGAAASAPQAAAPVPAPAAPAPAPAPQAAPAAAPAPAQAPAPAASGE
YRASHASPSVRKFARELGVDVSRVTGTGPKSRITKDDVTAFVKGVMTGQRAAPGAAAAPA
GGGELNLLPWPKVDFSKFGPFEAKPLSRIKKISGANLHRNWVMIPHVTNNDEADITELEA
LRVQLNKEHEKAGVKFTMLAFVIKAVVAALKKFPTFNASLDGDNLVFKQYYHIGFAADTP
NGLVVPVIRDADKKGLVDIAKEMAELSKAAREGKLKPDQMQGGCFSISSLGGIGGTHFTP
IINAPEVAILGLSRGQMKPVWDGKQFVPRLMLPLSLSYDHRVIDGAEAARFNAYLGALLA
DFRRIIL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgatcgaagtcaaggtgccggatatcggcgattacaaggacgtgcccgtc
atcgaagtgctcgtgaagccgggcgatgcggtcgagcccgagcagtcgctcgtcacgctc
gaatcggacaaggcgacgatggatgtgccgagcccgtcggcgggcacggtcaaggaagtg
aaggtgaaggtcggcgacgcggtgtcgcaaggctcgctgatcgtgctgctcgacggcgcg
caggcggcggcccagcccgcgcaggcgaacggcgccgcgacgagcgccgcgcagccggcg
gcggcgcccgctgccgcgcctgcgccggcggcggccgcgggcggcggcacggtcgacgtg
aaggtgccggacatcggcgactacaaggacgtgcccgtcatcgagatcgccgtgaagatc
ggcgacacggtcgagaaggagcagtcgctcgtcacgctcgaatcggacaaggcgacgatg
gacgtgccgagcccggccgcgggcgtcgtcaaggacatcaaggtgaaggtcggcgatgcg
gtgtcggaaggttcgctgatcgtcgtgctcgaagcgtcgggcggcgccgccgcgagcgcg
ccgcaggcggccgcgcccgtccccgcgccggccgcgccggctccggcgcccgcgccgcag
gccgcacccgcggctgcgccggcccccgcgcaggcaccggcacccgccgcgagcggcgag
taccgcgcgagccacgcgtcgccgtcggtgcgcaagttcgcgcgcgagctcggcgtcgac
gtgtcgcgcgtcacgggcacggggccgaagagccgcatcacgaaggacgacgtcaccgcg
ttcgtgaagggcgtgatgacgggacagcgcgcggcgcccggcgccgcggccgcgcccgcg
ggcggcggcgagctgaacctgctgccgtggccgaaggtcgacttctcgaagttcggcccg
ttcgaggcgaagccgctgtcgcgcatcaagaagatctcgggcgcgaacctgcatcgcaac
tgggtgatgatcccgcacgtcacgaacaacgacgaggcggacatcaccgagctcgaagcg
ctgcgcgtgcaactgaacaaggagcacgagaaggcgggcgtgaagttcacgatgctcgcg
ttcgtgatcaaggcggtcgtcgccgcgctgaagaagttcccgaccttcaacgcgagcctc
gacggcgacaacctcgtgttcaagcagtactaccacatcggtttcgccgccgacacgccg
aacggcctcgtcgtgccggtgatccgcgacgcggacaagaaggggctcgtcgacatcgcg
aaggaaatggccgagctgtcgaaggccgcgcgcgaaggcaagctcaagccggaccagatg
cagggcggctgcttctcgatctcgtcgctcggcgggatcggcggcacgcacttcacgccg
atcatcaatgcgccggaagtggcgatcctcgggctgtcgcgcggccagatgaagccggtg
tgggacggcaagcagtttgtgccgcgcctcatgctgccgctgtcgctgtcgtatgaccat
cgcgtgatcgatggcgcggaagccgcgcggttcaatgcgtatctcggcgcgttgcttgcc
gatttccgtcgcatcattctttga

DBGET integrated database retrieval system