KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_2868Help
Entry
BURPS1710b_2868   CDS       T00289                                 

Definition
hypothetical protein
Orthology
K08983  
putative membrane protein
Organism
bpm  Burkholderia pseudomallei 1710b
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3178487..3178948)
Genome map
AA seq 153 aa AA seqDB search
MLTVRWLLAAVHLLGFGFAFASIAARNRALKRVAGSRQAADLSDVFKADAIWGVSALVLI
MTGIVRAFGGFEKGGDYYLHAPLFHLKMGALALILVLELVPMTGLIRWRMTARRGMLPEL
ARARAYARIGHVQAMLVAVIVLAAAGMARGVGF
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccgtccgatggctgctcgccgccgttcatttgctcgggttcggcttcgcgttc
gcgtcgatcgccgcgcgcaaccgtgcgctcaagcgcgtcgccggctcgcggcaggccgcc
gatctgtccgatgtgttcaaggccgacgcgatctggggcgtgtccgcgctcgtgctgatc
atgacgggcatcgttcgcgcgttcggcggcttcgagaagggcggcgactattatctgcat
gcgccgctctttcatctgaagatgggtgcgctcgcgctgatcctcgtgctcgagctcgtg
ccgatgacgggcctcatccgctggcggatgaccgcgcggcgggggatgctgcccgagctc
gcgcgcgcgcgcgcgtatgcgcggatcggccacgtgcaggcgatgctcgtcgcggtgatc
gtgctcgcggcggccgggatggcgcgcggcgtcgggttctga

DBGET integrated database retrieval system