KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_2952Help
Entry
BURPS1710b_2952   CDS       T00289                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bpm00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:bpm00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:3259683..3260186
Genome map
AA seq 167 aa AA seqDB search
MTTLTLIVARARNGVIGRDNRLPWKLPEDLAFFKRTTMGAPIVMGRKTHESIGRPLPGRR
NIVVTRDAARRFDGCDTATSLDDALALAARDGAAEAFLIGGAQLYEEGLRHADKLIVTEI
DQDFEGDASFPAPDPAQWEAVSRDAHRAAQPNDFTYAFVVYRRRRAG
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgctgaccttgatcgtcgcgcgcgcccgcaacggcgtgatcggccgcgacaac
cgacttccgtggaaactccccgaggacctcgcgttcttcaagcgcacgacgatgggcgcg
ccgatcgtgatgggccgcaagacgcacgaatcgatcggccggccgctgccggggcgccgc
aacatcgtcgtcacgcgcgacgccgcgcgccgcttcgacggctgcgacacggccacctcg
ctcgacgacgcgctcgcgctcgccgcgcgcgacggcgcggccgaagcgttcctgatcggc
ggcgcgcaactgtacgaggaaggcctgcgccacgcggacaagctgatcgtcaccgaaatc
gatcaggatttcgaaggcgacgcgtcgttccccgcgcccgatcccgcgcaatgggaagcc
gtgtcgcgcgacgcgcaccgcgcggcgcagcccaacgatttcacgtacgcgttcgtcgtc
tatcgccgcaggcgcgccggctga

DBGET integrated database retrieval system