KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_3049Help
Entry
BURPS1710b_3049   CDS       T00289                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bpm00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3361487..3362170)
Genome map
AA seq 227 aa AA seqDB search
MTDSNRDGAAAHSLHAGVYPGNLFMVVAPSGAGKSTLVNALLSKDPEIRLSISYTTRKPR
PGEQDGQHYHFTTVEDFRERHARHEFLESAEVHGNYYGTSRVWIEEQMKIGHDVLLEIDW
QGAQQVKKQFRNAVGIFILPPSLAALEERLKKRGQDEPNVITRRLLAAGSEIAHAAEAQY
VVINETFEHALAELECIVAATRLRFTSQYARHAELFVELGIHLPHAE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattcgaaccgcgacggcgcagccgcgcattcgctgcacgccggcgtctatccc
ggcaatctcttcatggtcgtcgcgccgtcgggcgcgggcaagtcgacgctcgtcaacgcg
ctgctgtcgaaggacccggagattcgcctgtcgatttcgtacacgacgcgcaagccgcgc
cccggcgaacaggacggccagcactatcacttcacgaccgtcgaggatttccgcgagcgc
catgcgcgccacgagtttctcgaaagcgccgaggtgcacggcaattactacggcacgtcg
cgcgtgtggatcgaagagcagatgaagatcggccacgacgtgctgctcgaaatcgattgg
cagggcgcgcagcaggtgaagaagcagttccgcaacgcggtcggcatcttcatcctgccg
ccgtcgctcgcggcgctcgaggagcggctcaagaagcgcgggcaggacgagccgaacgtg
atcacgcggcgcctgctcgccgcgggcagcgagatcgcgcacgcggcggaagcgcagtac
gtcgtcatcaacgagaccttcgagcacgcgctcgccgagctcgagtgcatcgtcgcggcg
acgcgcctgcgcttcacgtcgcaatatgcgcggcatgccgaactattcgtcgagctcggc
attcatctgccgcacgcggagtga

DBGET integrated database retrieval system