KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_3090Help
Entry
BURPS1710b_3090   CDS       T00289                                 

Gene name
glk
Definition
bifunctional glucokinase/RpiR family transcriptional regulator (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BURPS1710b_3090 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BURPS1710b_3090 (glk)
   00052 Galactose metabolism
    BURPS1710b_3090 (glk)
   00500 Starch and sucrose metabolism
    BURPS1710b_3090 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    BURPS1710b_3090 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BURPS1710b_3090 (glk)
   00524 Butirosin and neomycin biosynthesis
    BURPS1710b_3090 (glk)
Enzymes [BR:bpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BURPS1710b_3090 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:3394719..3396644
Genome map
AA seq 641 aa AA seqDB search
MSTGAQTKAAAASQHADGPRLLADVGGTNARFALETGPGEITQIRVYPGAEYPTLTDAIR
KYLKDAKIGRVNHAAIAIANPVDGDQVRMTNHNWSFSIEATRRALGFDTLLVVNDFTALA
MALPGLTDAQRVQIGGGTRRQNSVIGLMGPGTGLGVSGLIPADDRWIALGSEGGHATFAP
MDEREDLVLQYARRKYPHVSFERVCAGPGMEIIYRALAARDKKRIAANVDTADIVERAHA
GDALALEAVECFCAILGTFAGNLAVTLGALGGIYIGGGVVPKLGELFMRSPFRARFEAKG
RFEAYLANIPTYLITAEYPAFLGVSAILAEQLSNRTGGASSAVFERIRQMRDALTPAERR
VADLALNHPRSIINDPIVDIARKADVSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTIPM
SHSQVHLGDTATDFGAKVLDNTVSAILQLREHLNFEHVEQAIDILNNARRIEFYGLGNSN
IVAQDAHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLDVAMQ
AGAKVIAITSSNTPLAKRATVALETDHIEMRESQLSMISRILHLVMIDILAVGVAIRRAA
PNAELAEAMARAKARAGASAGDEAADVLDWLSHGAAPAAKD
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgtctactggtgcgcaaactaaggccgccgcggcgagccagcacgcggacgggccgcgc
ctattggccgacgtcggcggcacgaacgcgcgcttcgcgctcgagacgggcccgggagaa
atcacgcagatccgcgtgtacccgggcgccgagtatccgacgctcaccgacgcgatccgc
aagtatctgaaggacgcgaagatcggccgcgtgaatcacgcggcgatcgcgatcgcgaac
cccgtcgacggcgatcaggtccggatgacgaatcacaactggagcttctcgatcgaggcg
acgcgccgcgcgctcggcttcgatacgctgctcgtcgtcaacgatttcaccgcgctcgcg
atggcgctgcccggcctgaccgatgcgcagcgcgtacagatcggcggcggcacgcgccgg
cagaacagcgtgatcggcctgatggggccgggcacggggctcggcgtgtcggggctcatt
cccgccgacgaccgctggatcgcgctcggcagcgaaggcggccacgcgacgttcgcgccg
atggacgagcgcgaggatctcgtgctgcagtacgcgcgccgcaagtatcctcacgtgtcg
ttcgagcgcgtgtgcgcgggcccgggcatggagatcatctatcgcgcgctcgccgcgcgc
gacaagaagcgcatcgccgcgaacgtcgacacggccgacatcgtcgagcgcgcgcacgcg
ggcgatgcgctcgcgctcgaggcggtcgagtgcttctgcgcgattctcggcacgttcgcc
ggcaacctcgcggtcacgctcggcgcgttgggcggcatctatatcggcggcggcgtcgtg
ccgaagctcggcgagctgttcatgcgctcgccgtttcgcgcgcgcttcgaggcgaagggc
cgcttcgaggcgtatctcgcgaacatcccgacctacctgatcaccgcggaatacccggcg
tttctcggcgtatcggcgatcctcgccgagcaactgtcgaaccgcacgggcggcgcgtcg
tcggccgtgttcgagcgcatccgccagatgcgcgacgcgttgacgcccgccgagcggcgc
gtcgccgatctcgcgctcaaccatccgcgctcgatcatcaacgatccgatcgtcgacatc
gcgcgcaaggccgacgtgagccagcccaccgtgatccgcttctgccgctcgctcggctgc
caggggctgtcggacttcaagctgaagctcgcgacgggcctcaccggcacgatcccgatg
agccacagccaggtgcatctgggcgacaccgcgaccgatttcggcgcgaaggtgctcgac
aacacggtatcggcgatccttcagttgcgcgagcatctgaacttcgagcacgtcgagcag
gcgatcgacatcctgaacaacgcgcggcgcatcgagttctacggcctgggcaattcgaac
atcgtcgcgcaggacgcgcactacaagttcttccgcttcgggattccgacgatcgcgtac
ggcgacctgtacatgcaggcggcgtcggccgcgctcctcggcaagggcgacgtgatcgtc
gcggtgtcgaagtcggggcgcgcgccggagctgttgcgcgtgctcgacgtcgcgatgcag
gcgggcgcgaaggtgatcgcgatcacgtcgagcaacacgccgctcgccaagcgcgcgacg
gtcgcgctcgagaccgatcacatcgagatgcgcgagtcgcagttgtcgatgatctcgcgg
atcctgcatctcgtgatgatcgacatcctcgcggtcggcgtcgcgatccgccgcgccgcg
ccgaacgcggagctcgcggaggcgatggcgcgcgcgaaggcgcgcgcgggcgcgagcgcg
ggcgacgaggccgccgacgtgctcgactggctgagccacggcgcggcgcccgcggcgaag
gactga

DBGET integrated database retrieval system