KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_3584Help
Entry
BURPS1710b_3584   CDS       T00289                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
bpm  Burkholderia pseudomallei 1710b
Brite
Enzymes [BR:bpm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     BURPS1710b_3584 (dsbC)
Secretion system [BR:bpm02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   BURPS1710b_3584 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3906604..3907341)
Genome map
AA seq 245 aa AA seqDB search
MICMKKTIRIAALALAAATATLGCTAQADQSTDKLKAALQSRLGADAPIKSVTKSPIAGL
YEVNLGSQIVYSDASGDYVLLGELVNTKTHKNLTAERLAEINKIDFASLPLSNAIKVVKG
NGARKIAVFSDPNCPYCKKLETTLQSVDNVTVYTFLYPVLSPDSTVKSKSIWCASDRVKS
WQSWMLEHRAPTSAANCDTTALDKNLALGRGMNVTGTPTVFLADGTRLPGAVSADELNQA
LAGVK
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgatttgcatgaaaaaaacgattcgtatcgccgcgctcgccctggctgccgcgacggcg
acgctcggctgcaccgcgcaggccgaccagtccaccgacaagctgaaggccgcgctgcaa
tcgcgcctcggcgccgacgcgccgatcaagagcgtgacgaagtcgccgattgcgggtttg
tacgaggtcaatctcggctcgcagatcgtctatagcgacgcatcgggcgattacgtgctg
ctcggcgagctcgtcaacacgaagacgcacaagaacctcacggccgagcgcctcgccgag
atcaacaagatcgatttcgcgagcctgccgctgtcgaacgcgatcaaggtcgtgaagggc
aacggcgcgcgcaagatcgcggtgttctccgatccgaactgcccgtactgcaagaagctc
gagacgacgctgcaatcggtcgacaacgtgaccgtctacacgttcctgtatccggtgctg
tcgcccgattcgacggtgaagtcgaagtcgatctggtgcgcgagcgaccgcgtgaaaagc
tggcagtcgtggatgctcgagcatcgcgcgcccacgagcgcggcgaactgcgacacgacc
gcgctcgacaagaacctcgcgctcggccgcggaatgaacgtgacgggcacgccgaccgta
ttcctcgccgacggcacgcgcctgccgggcgccgtatccgccgacgaactgaatcaggcg
ctcgccggcgtcaagtga

DBGET integrated database retrieval system