KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_3662Help
Entry
BURPS1710b_3662   CDS       T00289                                 

Definition
cell wall surface anchor family protein (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BURPS1710b_3662
Enzymes [BR:bpm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     BURPS1710b_3662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:4000822..4002801
Genome map
AA seq 659 aa AA seqDB search
MRTNHTKGFARLAIAAAIGAALTACGGGSSPNASTTSQPTTAAAGSMTGTVAIGTALTGA
TVTVTDANGKTVSATSGANGAYSVSLTGLSAPLLITAADPSGVSGTLYSVVASANTTNGA
PVTANVTPLTTAAAALMTESGNPADLAGNASAITPSAVTAAETTLDAAIAPILSANSVPA
SFDPIGSAFTPNQAGADAVIDSVAVTPSVSGSGLQITSLANPDTAIQLNSSTSVSTALAA
PSHAANYLAGLQASLSACASDVQGGATDTSDSNCTSAIDASYVNNGVGTGVAGFTKRHTL
FTKGTVLTGIRTVAFVPAGTLAGINNPAALVYLLMTDPDGTPDYGMDYVQQLPNGQWDII
GNQLQDSTSIASFIGRVQYTDSADAGNARYESGLDIQIPSSVKVNGTAAGVGSAVVTGPG
LPSSGLWLQTAGNGTGAGYLEIPTGTLTAPLTSLGNRVSGGMSTAYKWAWAPLSGSTTSF
SPNGLPEYASSSQNVSTISNFGIYTVTLYDTTGTEIRSEQVQNIARNYAAAAGGAVAWQT
LGNDVIANYLTPGGSGTKSAPGTSATLDWTTPAGSFYPNFWASINSLGTAQNGVPTTTYD
ATVWGASTGNTPSPLVFNTPFTDVLTSTATATAEQVVQVQLGWATDGEKYLNIWQYGHP
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
gtgagaacgaatcacaccaaggggttcgcaagactggcaatagccgcagcgatcggggca
gcgctcaccgcttgcggaggcggtagcagccccaacgcatcgacaacaagccagccaacg
acggccgccgccggttcgatgaccgggactgtcgccatcggtaccgcgctgactggcgcg
acggtcaccgtgacggatgcgaacggcaagacggtttcggccacgtcaggtgccaatgga
gcctacagcgtttctctgaccggactgagcgcgccgctcctgatcaccgccgccgatccg
tccggtgtctcgggcacgttgtattccgtcgtcgccagcgccaacaccaccaatggcgcg
cccgtgacggcgaacgtcacaccgctgacgacggcagccgcggcgctcatgactgagtcg
ggtaatccggcagatctcgctggtaacgcatcggcaatcacgccgtctgccgttactgcg
gcggaaaccacactcgacgcggcgatcgcgccgatcctgtcggccaacagcgttccggcc
tcgttcgatcccatcggctccgctttcactccgaaccaggcgggcgcagatgcagtgatc
gattccgtcgcagtcacgccctcggtctcgggctccggactgcagattacgagtcttgcc
aatcccgatacggccattcagctcaactccagcacgagtgtatccaccgcgctcgcggcc
ccctcccatgccgcaaactacctggccggcctgcaagcatcattgagcgcctgcgcgtcg
gatgttcagggcggcgctacggacacgtctgacagcaactgcacttcggcgatcgacgcg
agctatgtgaacaacggagtcggcacgggcgtcgccggcttcaccaagcgtcacacactc
ttcaccaaagggacggtgctgactggcatcaggaccgtcgcattcgtcccggccggtacg
cttgccggcatcaacaatccggctgcgcttgtctatctgctgatgaccgacccggacggc
acgccggactatggcatggattacgtgcagcagttgcctaacggccagtgggacatcatc
ggcaatcagttgcaagacagcacctccatcgcgtcgttcatcggtcgcgttcagtacacg
gattcggcggatgcgggcaacgcgcgctatgagtcgggtctcgatatccagatcccgtct
tcggtgaaggtcaacggtacggccgcgggtgttggttctgccgtggtgacggggccgggc
ctgccctccagcggcctgtggctccagaccgcgggtaacggcaccggcgccggctatctg
gagattccgacgggcacgctgaccgcgcccctcacgagcttgggcaatcgcgtcagtggt
ggcatgtccacggcctataagtgggcatgggcgccgctttcgggcagcacgacgtcgttc
tcgccgaacggtctgccggagtatgcgtcgtcatcgcaaaacgtctcgacaatctcgaac
ttcggcatctacaccgtcacgctgtacgacacgaccggtaccgagatccgttcggagcag
gtccagaacatcgcccgaaactatgcagcagcggctggcggcgccgtggcctggcagaca
ctcggcaacgacgtgatcgcgaattacctgacgcccggtggttccggtaccaagagtgca
ccgggtacttcggccacgctcgactggacgacgccggctggctcgttctacccgaacttc
tgggcatcgatcaattcgctcggtacagcccagaacggcgtaccgaccacgacctacgat
gcaacggtatggggagcgagtacgggcaacacgccgtcgccgttggtgttcaatacgccg
ttcaccgatgtgttgacctcgactgccaccgcgacagcggaacaagtcgttcaggtgcag
ctcggctgggcaactgatggcgaaaaatatctcaacatctggcagtacgggcatccataa

DBGET integrated database retrieval system