KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A0197Help
Entry
BURPS1710b_A0197  CDS       T00289                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbomyltransferase
  KO
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    BURPS1710b_A0197 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BURPS1710b_A0197 (pyrB)
Enzymes [BR:bpm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     BURPS1710b_A0197 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
II:298907..300166
Genome map
AA seq 419 aa AA seqDB search
MRRLNMTREAFANRIGVSRRALDTWLLPDDSQESRGMPEIVERFVSEIVERAPAADGYAQ
SVDSRQPLAQQFLFEGRPQLLSVDQFSRDSVEALFRVADVMQPIARRRKISRVLEGAVLG
NLFFEASTRTRVSFGAAFCRLGGSVCDTTGFTFSSMAKGESIYDTSRVMAGYVDALVIRH
PEQGSVAEFARATNLPVINGGDGPGEHPSQALLDLYTIQREFSRLGKIVDGACIALVGDL
KYGRTVHSLVKLLALYRGLKFTLVSPPTLEMPAYIVDQISKNGHVVEETHDLAAGLKGAD
VVYATRIQKERFTDESFEGYTPDFQINQARVDAACGPDTLIMHPLPRDSRPGANDLSTDL
NRDPRLAIFRQTDNGIPVRMAIFAVLLGVEHLVQHSMRDATWRPPTYLGPEDAVFHGID
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcctgaacatgacccgcgaagcgttcgcgaaccgcatcggcgtgagccggcgc
gccctcgacacatggctgttgccggacgattcgcaggaatcgcgcggcatgcccgagatc
gtcgagcgtttcgtctccgaaatcgtcgagcgcgcgccggccgccgacggatatgcgcaa
agcgtagattctcgacagccgcttgcgcagcagttcctgttcgaaggccggccgcagttg
ctgtcggtcgaccagttctcgcgcgattccgtcgaagcgctgttccgggtcgccgacgtg
atgcagccgatcgcgcgccgccgcaagatctcgcgcgtgctcgagggcgcggtgctcggc
aacctgttcttcgaggcgagcacgcgcacgcgcgtgtcgttcggcgccgcgttctgcagg
ctcggcggctcggtgtgcgacacgacgggcttcaccttctcgtcgatggccaagggtgaa
tcgatctacgatacgagccgcgtgatggccggctacgtcgacgcgctcgtgatccgccat
ccggaacaaggctcggtcgccgaattcgcgcgcgcgaccaacctgcccgtgatcaacggc
ggcgacggccccggcgagcatccgagccaggcgctcctcgatctgtatacgatccagcgc
gaattctcgcgcctgggcaagatcgtcgacggcgcgtgcatcgcgctcgtcggcgacctg
aagtacggccgcacggtccactcgctcgtcaagctgctcgcgctgtatcgcgggctcaag
ttcacgctcgtatcgccgccgacgctcgagatgccggcctacatcgtcgatcagatctcg
aagaacggtcacgtcgtcgaggaaacgcacgacctcgcggcgggcctgaagggcgcggac
gtcgtctacgcgacgcgaatccagaaggagcgcttcaccgacgaatcgttcgaaggctat
acgcccgacttccagatcaatcaggcacgggtcgacgcggcctgcggccccgacacgctg
atcatgcacccgctgccgcgcgacagccggcccggtgcgaacgatctgtcgaccgatctg
aaccgcgacccgcgcctcgcgatcttccgccagaccgacaacgggattccggtgcgcatg
gcgatcttcgcggtgctgctcggcgtcgagcatctcgtccaacactcgatgcgcgacgcg
acgtggcgtccacccacgtacctcgggccggaggacgcggtgttccacgggatcgactaa

DBGET integrated database retrieval system