KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A0283Help
Entry
BURPS1710b_A0283  CDS       T00289                                 

Definition
putative oxidoreductase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BURPS1710b_A0283
Enzymes [BR:bpm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BURPS1710b_A0283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(426122..430051)
Genome map
AA seq 1309 aa AA seqDB search
MRCVRMCRAPRRRRVRAPGGIDKPRALPQACAHEFPWLSHRAHYSHHSSNGGLARVRKQS
QQTRPVRRVFCFRLPGIPPRRACHAVRRRRHGNPRSAPPRSRRAHGDRAARAHARRLPEA
GPERARVRRRARDGARTRAQPVRAAGQRRLPEARGQPAGVLVQAARRVQQDGAHPGRRAR
ARGDHRVGGQPCAGRRVLGRADEREGGDRRAGDDAAGEGRRGARARRADRRGDPGGRIVQ
RRVRARGEGAGRARPHVRPSVRRSVRDRGPGHGRDGDPAPASGADSRDLRADRRRRARGG
RGRVREGGAPGDQGDRRADRRFVRDEAIARGGPARRAHRGRALLRRHRGQARRRGDVPPL
RGVSRRGRDRRYRRALRGDQGRVPGHAQRARAGRLARGGGREAVCGAGGHRGRDARGGYL
RREHEFRPDALRRRARRGGRGARGGVRGDDSRGARQLQALLRARRRAQRDRVQLPDRRCA
IGASLRRCADRASRRLGDDRGELRRARLRHRRSERRRARETARATHGGRALAARARRAAV
PLRVSRAARRADEVPVVDGARLEHQPVPLPQSGRRRELDPRRPASAAGGPRGVRSLSRGA
RLSVSRGNRSSRLSVVSRLTFAAPAARGRRRVGGVASARCVARGSRLGVAPARAFAFVRV
PDGAFVVAQARRRQPLAEREQRAEQRREIVRAHRQRALLRADEAQVGHLREQRRIRLAAQ
RLPAERMRGGEARAIRAALEFGDERLVQRPGPDCRLAARIHLRRGGQIPVERRLGRAAGL
QQRDRLRRIRGFPFGEQREHERLSAAEVVIERAARDAQASREAVGRHALRAFVVERGEAR
RDPVRSCRSCHENVQALYGPIVAAIVRPRSTLVAALAMHVLVVGAGIAGLAAAWQLKRGG
CDVTVVEAAERAGGRIRSAPFHGHVIECGAQFPSSGYRHLMPLFGEAGLDAQLVKTSPWA
AFEHRGRLFRVHARRPWTIPASGLLGWRDSVRVSRARAALLARVRALDPNRYAAFAEFDD
ADAAHWAERAFGRAAVDAIFAPMIHGLYFQPLRGASRALLAAVTGFDGADTLAVAGGWQT
LPVALAARLDVRYGTRVDALSAHANGVDACVGDRALRFDAAIVATPATVARRLWRGQTDA
QRALLATGYARCAHVAFGLAPGWRAPARLRRVYGALLSPHARRVAALTFERGRGIGDGQG
EVVSAMLGHAGASALRYASDDEIARVALDDLRTLLPGVAEAVVATRVQRWDEAEPLSPVG
RARAIAAYRASIDARPRVLLAGDYMGSPWTDGAAETGRWAARRLLDARA
NT seq 3930 nt NT seq  +upstreamnt  +downstreamnt
atgcgatgcgtcaggatgtgccgcgcgccgcggcggcggcgcgtacgcgcgccgggcggg
attgacaaaccgcgcgcgctgccgcaagcttgcgcacatgaattcccttggctttcgcat
cgcgcacattattcgcaccattcatcgaatggtgggttagcgcgcgtccgaaagcagtca
cagcaaacccgccccgtgaggcgggttttttgtttccgtctcccgggcatccctcccagg
agagcctgtcatgcagtcagacgacgtcgtcacggaaacccccgaagcgcacccccgcga
agccgtcgcgcccacggcgatcgcgccgcgcgcgcgcacgctcgacgattacctgaagct
ggtcctgaacgcgcgcgtgtacgacgtcgcgcgcgagacggcgctcgaacgcgcgcgcaa
cctgtccgcgcggctgggcaacgccgtctacctgaagcgcgaggacaaccagccggtgtt
ctcgttcaagctgcgcggcgcgtacaacaagatggcgcacatcccggccgacgcgctcgc
gcgcggggtgatcaccgcgtcggcgggcaaccatgcgcagggcgtcgcgttctcggccgc
gcggatgaacgtgaaggcggtgatcgtcgtgccggtgacgacgccgcaggtgaaggtcga
cgcggtgcgcgcgcacggcgggccgaccgtcgaggtgatccaggcgggcgaatcgtacag
cgacgcgtacgcgcacgcggtgaaggtgcaggccgagcgcggcctcacgttcgtccatcc
gttcgacgatccgtacgtgatcgcgggccagggcacggtcgcgatggagatcctgcgcca
gcatcaggggccgattcacgcgatcttcgtgccgatcggcggcggcgggctcgcggcggg
cgtggccgcgtacgtgaaggcggtgcgcccggagatcaaggtgatcggcgtgcagaccga
cgattcgtgcgcgatgaagcaatcgctcgcggcgggccggcgcgtcgagctcaccgaggt
agggctcttctccgacggcaccgcggtcaagctcgtcggcgaggagacgttccgcctctg
cgcggcgtatctcgacgaggtcgtgaccgtcgataccgacgcgctttgcgcggcgatcaa
ggacgtgttccaggacacgcgcagcgtgctcgagccggccggctcgctcgcggtggcggg
cgcgaagcggtatgcggagcaggcgggcatcgagggcgagacgctcgtggcggttacctc
cggcgcgaacatgaatttcgaccggatgcgcttcgtcgccgagcgcgccgaggtgggcga
ggcgcgcgaggcggtgttcgcggtgacgattcccgaggagcgcggcagcttcaagcgctt
ctgcgcgctcgtcggcgagcgcaacgtgaccgagttcaactaccggatcgccgatgcgcg
atcggcgcatctcttcgtcggtgtgcagatcgggcatcgcggcgactcggcgacgatcgc
ggcgagcttcgtcgcgcacggcttcggcaccgtcgatctgagcggcgacgagctcgcgaa
acagcacgtgcgacacatggtgggcgggcgctcgccgctcgcgcacgacgagcggctgtt
ccgcttcgagtttcccgagcggcccggcgcgctgatgaagttcctgtcgtcgatggcgcc
cgactggaacatcagcctgttccattaccgcaatcagggcggcgacgcgagctcgatcct
cgtcggcctgcaagtgccgcgggcggaccacgcggcgttcgatcgctttctcgcggcgct
cggttatccgtatcgcgaggaaaccggtcatcccgcctatcggttgtttctcggttgacg
ttcgccgcgccggccgcgcgcgggcgccggcgggtaggcggcgtcgcgtccgcgcgatgc
gtcgcccgcggctcgcggctcggcgtcgcgcccgcgcgcgccttcgcgttcgtccgggtt
cccgacggcgcgttcgtcgttgcgcaggcccggcgcagacagccgctcgccgagcgcgaa
cagcgagcggaacagcgtcgcgaaatcgtccgggcccatcggcagcgggctttgctgcgc
gccgacgaagcacaggtaggccacctgcgcgaacagcgccgcatccgcctcgctgcgcag
cgtctgccggcagaacgcatgcgcggcggcgaggcgcgcgcgatccgcgcggcgctggaa
ttcggcgacgagcggctcgtgcagcgaccaggtccggattgccgcctcgcggcgcggatt
catctgcgacgcggcggccagataccggtcgagcgccgcctcgggcgggccgccggcttg
cagcagcgcgatcgcctgcgtcgtatacgcggcttcccattcggcgagcagcgcgagcac
gaacgcctttcggctgccgaagtggtgatagaacgcgccgcgcgtgacgcccaggcgtcg
cgcgaggcggtcggccgacacgccttgcgcgccttcgtcgtcgagcgcggcgaggcccgc
cgcgatccagtccgttcgtgtcgttcttgccatgaaaacgtacaggctttgtatggtccg
atcgtggcggctattgtacggcctcgttcaaccctcgtcgccgcgctcgccatgcatgta
ctcgtcgtcggagcaggaatcgccgggctcgccgccgcctggcaattgaaacggggcgga
tgcgacgtgaccgtcgtcgaggccgccgaacgcgcgggcggccgcattcgcagcgcgccg
ttccacggccatgtgatcgaatgcggcgcgcagtttccgtcctccggctatcggcacttg
atgccgctcttcggcgaggcggggctcgatgcgcaactcgtgaagacctcgccgtgggcg
gcgttcgagcatcgcgggcggctctttcgcgtgcatgcgcggcggccgtggacgatcccc
gcgagcggcctgctcggctggcgcgacagcgtgcgcgtgagccgggcgcgcgccgcgctg
ctcgcgcgggttcgcgcgctcgatccgaaccgctatgcggcgttcgcggaattcgacgat
gccgacgcggcccactgggcggaacgcgcgttcgggcgcgcggcggtcgacgcgatcttc
gcgccgatgattcacgggctgtatttccagccgctgcgcggcgcgtcgcgcgcgctgctc
gcggccgtcaccggcttcgacggcgcggatacgctcgcggtcgcgggcggctggcagacg
ctgcccgtcgcgctcgcggccaggctcgacgtgcgctacggcacgcgggtcgatgcgctg
tcggcgcacgcgaacggcgtcgacgcgtgcgtcggcgatcgcgcgctgcgtttcgacgcg
gcgatcgtcgcgacgcccgcgaccgtcgcgcgccgcctctggcgcgggcagaccgacgcg
cagcgcgcgctgctcgcgacgggctatgcacgctgcgcgcacgtcgcgttcggcctcgcg
ccgggctggcgcgcgcctgcgcggctgcgccgcgtgtacggcgcgctgctgtcgccgcac
gcgcgacgcgtcgcggcgctcacgttcgagcgcgggcgcgggatcggcgacgggcagggc
gaggtcgtatcggcgatgctcgggcatgcgggcgcgagcgcgctgcgctatgcatcggac
gacgagatcgcgcgcgtcgcgctcgacgacctgcgcacgctgttgccgggcgtcgccgag
gcggtcgtcgcgacgcgcgtgcagcgctgggacgaggccgagccgctgtcgcccgtcggc
cgcgcgcgcgcgatcgccgcataccgcgcgagcatcgacgcgcgcccgcgcgtgctgctc
gcgggcgactacatgggctcgccgtggaccgacggcgcggcggagacgggcagatgggcg
gcgcgcaggctgctcgacgcgcgcgcatga

DBGET integrated database retrieval system