KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A0632Help
Entry
BURPS1710b_A0632  CDS       T00289                                 

Gene name
bcsZ
Definition
(GenBank) endoglucanase precursor (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
bpm  Burkholderia pseudomallei 1710b
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
II:complement(829945..831465)
Genome map
AA seq 506 aa AA seqDB search
MARQAGRDEGVGRIGREAGDAREAAGAGEACGRRHARADTWARRASRASRGWRTFWRGRG
GVRAVVASVVASFSVMAFAAATLPVSWRVAAAAERTRSGGERAGGLRDTAGLIEISAAAP
ASTPIPAAPRRFAQPFAQPARAFAAASACAPSWPRWDRFKRDFVSADGRVIDVGSADERT
VSEGQAYGLFFALVANDRAAFDALLRWTEDNLAQGDLSARLPAWLWGRAADGAWRVLDAN
AASDADLWLAYALLEAGRLWRERSYTARGALLAKRVLDEETATLPGLGLVLLPGPTGFRP
ARDAWRLNPSYSPPQAIRGIGAHVPDDARWARLAAGVGRVLTDSAPRGFAPDWALYRAGR
GFEPDAETHAASAYNAIRVYLWAGMLDAGDPLARPLVAHFAPFAEHVAAHGAPPEAVDAT
TGAAAPRDGNAGFSAAAVPFLEARGERASADAQLARVARLERETASGYYANVLTLFGLGW
RDGRYRFAADGTLRVRWSEPCSTPAR
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggcaagcagggcgagacgaaggcgtcgggcgcatcgggcgtgaagcgggcgac
gcgcgcgaggcggccggggcgggcgaggcgtgcgggaggcgccacgcgcgggccgacacg
tgggcgcggcgggcgtcgcgagcatcgcgcgggtggcgcacgttttggcgcgggcgcggg
ggcgtgcgcgccgtcgtggcgagcgtcgtggcgagcttctcggtgatggcgttcgcggcg
gcgacgttgccggtgtcgtggcgcgtcgccgcggcggcggagcgtacgcgaagcggcggc
gaacgcgcgggcgggctgcgcgacacggcgggcttgatcgagatctcggcggcggcgccg
gcctcgacgccgatcccggcggcgccgcggcggttcgcgcagccgttcgcgcagccggct
cgcgcgttcgccgccgcgagcgcctgcgcgccgtcctggccgcgctgggaccgtttcaag
cgtgacttcgtatcggccgacggccgcgtgatcgacgtcggctcggccgacgagcggacc
gtatccgaggggcaggcgtacggccttttcttcgcgctcgtcgcgaacgaccgcgcggcg
ttcgacgcgctgctgcgctggaccgaggacaatctcgcgcagggcgatctgagcgcgcgt
ctgcccgcgtggctgtggggccgcgcggccgacggcgcgtggcgcgtgctcgatgcgaac
gccgcgtccgacgccgatctgtggcttgcgtacgcgctgctcgaagcggggcgcttgtgg
cgcgagcgcagctacacggcgcgcggcgcgttgctcgcgaagcgcgtgctcgacgaggag
accgcgacgctgccggggctcggtctcgtgctgctgccgggcccgacgggttttcggccg
gcgcgcgacgcgtggcggctgaatccgagctattcgccgccgcaggcgattcgcgggatc
ggcgcgcatgtgcccgacgacgcgcgctgggcgcggctcgcggcgggcgtcggccgcgtg
ctgaccgacagcgcgccgcgcggcttcgcgccggactgggcgctgtatcgcgcgggccgc
ggcttcgagccggacgccgaaacgcatgcggcgagcgcgtacaacgcgattcgcgtctat
ctgtgggcgggcatgctcgatgcgggcgacccgttggcgcggccgctcgtcgcgcatttc
gcgccgttcgccgagcatgtcgccgcgcatggcgcgccgccggaggcggtcgatgcgacg
acgggcgcggccgccccgcgcgacggcaatgccgggttttccgcggcggccgtgccgttt
ctcgaggcgcgcggcgagcgggcgagcgccgacgcgcagctcgcgcgcgtcgcgcggctc
gagcgcgagacggcgagcggctattacgcgaacgtgctgacgctgttcgggctcggctgg
cgcgacgggcgctaccggttcgcggccgacggcacgctgcgggtgcgatggagcgagccg
tgctcgacgcccgcgcgttga

DBGET integrated database retrieval system