KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A0639Help
Entry
BURPS1710b_A0639  CDS       T00289                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bpm00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:838763..839716
Genome map
AA seq 317 aa AA seqDB search
MSDDYFQPQSGNAMPRFAGIATMMRLPQAASAAGLDACFVGVPFDLGTSNRTGARFGPRQ
IRSESVLLRPYNMATRAAPFDSLRVADLGDVATNPYNLADSIARIEAAYHAILAHGCRPV
TLGGDHTITLPILRAMHRRHGRVGLIHVDAHADVNDTMFGEKIAHGTPFRRALEEGLLDG
DRVVQIGLRGTGYAAEDFDWCRDQGFRVVQAEACWNRSLAPLMDEVRTRVQGGPVYLSFD
IDGIDPAYAPGTGTPEIAGLTVPQGLEIVRGAWGLDIVGADLVEVAPPYDPFGTTALLGA
NLAYEMLCVLPGVARRA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatgattacttccagccgcaaagcggcaacgcgatgccgcgcttcgccggcatc
gcgacgatgatgcggctgccgcaggcggcgagcgccgcggggctcgacgcgtgctttgtc
ggcgtgccgttcgatctcggcacgtcgaaccgcaccggcgcgcggttcggcccgcgccag
atccgcagcgaatccgtgctgctgcgcccgtacaacatggccacgcgcgcggcgccgttc
gattcgctgcgcgtcgccgatctcggcgacgtcgcgacgaacccgtacaacctcgccgat
tcgatcgcgcggatcgaggccgcgtaccacgcgatcctcgcgcacggctgccgcccggtc
acgctcggcggcgaccacacgatcacgctgccgatcctgcgcgcgatgcatcgccggcac
gggcgcgtcgggctcatccatgtcgacgcgcacgcggacgtcaacgacacgatgttcggc
gagaagatcgcgcacggcacgccgtttcgccgcgcgctcgaggaagggctgctcgacggc
gaccgcgtcgtgcagatcggcttgcgcggcaccggctatgcggccgaggatttcgactgg
tgccgcgatcagggctttcgcgtcgtccaggccgaggcgtgctggaaccgctcgctcgcg
ccgctgatggacgaagtgcgcacgcgcgtgcaaggcggcccggtctatctgagcttcgac
atcgacggcatcgatccggcgtacgcgccgggcaccggcacgccggagatcgccggcctc
acggtgccgcagggcctcgagatcgtgcgcggcgcgtgggggctcgacatcgtcggcgcc
gatctcgtcgaggtcgcgccgccgtacgatccgttcggcaccaccgcgctgctcggcgcg
aacctcgcttacgagatgctctgcgtgctgcccggcgtggcgcggcgcgcgtga

DBGET integrated database retrieval system