KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A0749Help
Entry
BURPS1710b_A0749  CDS       T00289                                 

Gene name
galU-2
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm00040  Pentose and glucuronate interconversions
bpm00052  Galactose metabolism
bpm00500  Starch and sucrose metabolism
bpm00520  Amino sugar and nucleotide sugar metabolism
bpm01100  Metabolic pathways
bpm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BURPS1710b_A0749 (galU-2)
   00052 Galactose metabolism
    BURPS1710b_A0749 (galU-2)
   00500 Starch and sucrose metabolism
    BURPS1710b_A0749 (galU-2)
   00520 Amino sugar and nucleotide sugar metabolism
    BURPS1710b_A0749 (galU-2)
Enzymes [BR:bpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BURPS1710b_A0749 (galU-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: ABA52841
UniProt: Q3JKJ5
Position
II:complement(993955..994938)
Genome map
AA seq 327 aa AA seqDB search
MPMRAVRRARRRPARAPELWRAAIRQHFRDAIMLKVTKAVFPVAGLGTRFLPATKASPKE
MLPVVDKPLIQYAVEEAINAGITEMIFVTGRSKRAIEDHFDKSFEIESELEARGKEKLLE
LVRGIKPSHVDCFYVRQPAALGLGHAVLCAEKLVHGEPFAVILADDLLHGDQPVLKQLVD
VFNHYHSSVIGVETIEREDSRSYGIVEGREWEEDIIKLSGIIEKPAPEHAPSNLGVVGRY
VLMPSIFEHLRKIKPGAGGELQLTDAVQSLLTEEQVLAYRYYGTRFDCGSKLGYLKATVE
LALRHPEVGREFEAYLRNCLPALAAVA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgcgcgccgtgcgtcgagcgcggcgccgcccggcgcgcgctcccgagctttgg
cgtgcggccattcgtcaacactttcgggatgcgatcatgttgaaagtcaccaaagccgtg
ttccccgttgccggtctcggcacacggtttttgcccgccacgaaggcgagtccgaaggaa
atgctgcccgtggtcgacaagccgctgatccagtacgcggtcgaagaggcgatcaatgcg
ggcatcaccgagatgatcttcgtgacgggccgcagcaagcgcgcgatcgaagatcacttc
gacaaatcgttcgagatcgaatccgagctcgaggcgcgcggcaaggaaaagctgctcgaa
ctcgtgcgcggcatcaagccgagccatgtcgactgcttctacgtgcgccagccggccgcg
ctcggcctcggccacgcggtgctctgcgcggagaagctcgtgcacggcgagccgttcgcg
gtgatcctcgccgacgacctgctgcacggcgaccagccggtgctcaagcagctcgtcgac
gtcttcaaccactatcacagctcggtgatcggcgtcgagacgatcgagcgcgaggacagc
cgctcgtacggcatcgtcgaaggccgcgagtgggaagaggacatcatcaagctgtcgggc
atcatcgagaagccggcgcccgagcatgcgccgtcgaacctcggcgtcgtcggccgctac
gtgctgatgccgagcatcttcgagcatctgcgcaagatcaagccgggcgcgggcggcgaa
ctgcaactgacggacgcggtgcagtcgctgctgaccgaggagcaggtgctcgcgtaccgc
tactacggcacccgtttcgactgcggcagcaagctcggctatctgaaggcgacggtcgag
ctcgcgctgcggcatccggaagtgggccgcgaattcgaggcgtacctgcgcaactgcctg
ccggcgctcgccgcggttgcttag

DBGET integrated database retrieval system