KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A0767Help
Entry
BURPS1710b_A0767  CDS       T00289                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BURPS1710b_A0767 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BURPS1710b_A0767 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BURPS1710b_A0767 (trpA)
Enzymes [BR:bpm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BURPS1710b_A0767 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
II:complement(1014048..1014971)
Genome map
AA seq 307 aa AA seqDB search
MRDRARTRRVARGRLRAGRRVSGAARAIANDLEKKAMSRIQNTFAALAAQGRKGLIPFIT
AGDPDPAKTVELMHALAEGGADVIELGVPFSDPMADGPVIQRSSERALAKGVTLHSVLDD
VKRFRARDQKTPVVLMGYANPIERMGADAFAAAARDAGVDGVLVVDYPPEESHDFAAKMR
AAGIDPIFLLAPTSTDDRIAAVGQVASGYVYYVSLKGVTGAANLDVSSIAGKIPAIKSRV
PLPVGVGFGIRDAATARAVAEVADAVVIGSRLVQLLEQAAPERAAAELAGFVAELRVAID
GAAKPAA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcgatcgcgcgcgaacgcgtcgcgtcgctcgcggccgtctccgcgccggccgacgc
gtaagcggcgcggcgcgcgcgatagcgaacgatctggaaaaaaaagccatgtcccgtatt
cagaacacttttgccgcactcgccgcccaaggtcgcaaggggctgattccgttcatcacc
gcgggagacccggacccggcgaagaccgtcgagctgatgcacgcgctcgccgaaggcggc
gccgacgtgatcgagctcggcgtgccgttctccgacccgatggccgacggccccgtgatc
cagcgctcgtcggagcgcgcgctcgcgaaaggcgtgacgcttcacagcgtgctcgacgac
gtgaagcgctttcgcgcgcgcgaccagaagacgcccgtcgtgctgatgggctacgcgaat
ccgatcgagcgcatgggcgcggacgcattcgccgcggccgcgcgcgacgcgggcgtcgac
ggcgtgctcgtcgtcgactatccgcccgaggaatcgcacgatttcgccgcgaagatgcgc
gcggcgggcatcgatccgatcttcctgctcgcgccgacgtcgaccgacgaccggatcgcc
gccgtcggccaggtggcgagcggctacgtctactatgtgtcgctcaagggggtgacgggc
gccgcaaatctggatgtttccagcattgcgggtaaaatcccggccatcaagtcgcgcgtg
ccgcttcccgtcggggtcggtttcggcatccgcgacgccgcgacggcgcgcgcggtggcc
gaggtggcggacgccgtcgtgatcggcagccgccttgtccagctgctggagcaggccgcg
ccggagcgggccgccgccgagctcgcggggttcgtcgccgagctgcgcgtcgcgatcgac
ggcgcggcgaagccggcggcatga

DBGET integrated database retrieval system