KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A0767Help
Entry
BURPS1710b_A0767  CDS       T00289                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
bpm00260  Glycine, serine and threonine metabolism
bpm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bpm01100  Metabolic pathways
bpm01110  Biosynthesis of secondary metabolites
bpm01130  Biosynthesis of antibiotics
bpm01230  Biosynthesis of amino acids
Module
bpm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BURPS1710b_A0767 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BURPS1710b_A0767 (trpA)
Enzymes [BR:bpm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BURPS1710b_A0767 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA Peripla_BP_6 PcrB His_biosynth B12-binding BtpA Amidohydro_2
Motif
Other DBs
NCBI-ProteinID: ABA52169
UniProt: Q3JKH7
Position
II:complement(1014048..1014971)
Genome map
AA seq 307 aa AA seqDB search
MRDRARTRRVARGRLRAGRRVSGAARAIANDLEKKAMSRIQNTFAALAAQGRKGLIPFIT
AGDPDPAKTVELMHALAEGGADVIELGVPFSDPMADGPVIQRSSERALAKGVTLHSVLDD
VKRFRARDQKTPVVLMGYANPIERMGADAFAAAARDAGVDGVLVVDYPPEESHDFAAKMR
AAGIDPIFLLAPTSTDDRIAAVGQVASGYVYYVSLKGVTGAANLDVSSIAGKIPAIKSRV
PLPVGVGFGIRDAATARAVAEVADAVVIGSRLVQLLEQAAPERAAAELAGFVAELRVAID
GAAKPAA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcgatcgcgcgcgaacgcgtcgcgtcgctcgcggccgtctccgcgccggccgacgc
gtaagcggcgcggcgcgcgcgatagcgaacgatctggaaaaaaaagccatgtcccgtatt
cagaacacttttgccgcactcgccgcccaaggtcgcaaggggctgattccgttcatcacc
gcgggagacccggacccggcgaagaccgtcgagctgatgcacgcgctcgccgaaggcggc
gccgacgtgatcgagctcggcgtgccgttctccgacccgatggccgacggccccgtgatc
cagcgctcgtcggagcgcgcgctcgcgaaaggcgtgacgcttcacagcgtgctcgacgac
gtgaagcgctttcgcgcgcgcgaccagaagacgcccgtcgtgctgatgggctacgcgaat
ccgatcgagcgcatgggcgcggacgcattcgccgcggccgcgcgcgacgcgggcgtcgac
ggcgtgctcgtcgtcgactatccgcccgaggaatcgcacgatttcgccgcgaagatgcgc
gcggcgggcatcgatccgatcttcctgctcgcgccgacgtcgaccgacgaccggatcgcc
gccgtcggccaggtggcgagcggctacgtctactatgtgtcgctcaagggggtgacgggc
gccgcaaatctggatgtttccagcattgcgggtaaaatcccggccatcaagtcgcgcgtg
ccgcttcccgtcggggtcggtttcggcatccgcgacgccgcgacggcgcgcgcggtggcc
gaggtggcggacgccgtcgtgatcggcagccgccttgtccagctgctggagcaggccgcg
ccggagcgggccgccgccgagctcgcggggttcgtcgccgagctgcgcgtcgcgatcgac
ggcgcggcgaagccggcggcatga

DBGET integrated database retrieval system