KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A0769Help
Entry
BURPS1710b_A0769  CDS       T00289                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BURPS1710b_A0769 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BURPS1710b_A0769 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BURPS1710b_A0769 (trpB)
Enzymes [BR:bpm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BURPS1710b_A0769 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
II:complement(1015766..1017031)
Genome map
AA seq 421 aa AA seqDB search
MPVRAAGAGNREPGAPRGRTESDVMYNLPDDRGHFGPYGGVFVAETLIHALDELRAAYEK
FKNDPEFVAEYNRELKHFVGRPSPIYHAQRWSETLGGAQIYLKREDLNHTGAHKVNNVIG
QALLAKRMGKRRVIAETGAGQHGVATATICARFGMECVVYMGAEDVRRQAANVYRMKLLG
ATVVPVESGSRTLKDALNEAMRDWVTNIERTFYIIGTVAGPHPYPMMVRDFQRVIGDECK
VQMPELAGRQPDAVIACVGGGSNAMGIFYPYIDDAAVQLIGVEAAGDGLDTGHHAASLIA
GSPGVLHGNRTYLLQDDDGQIIETHSVSAGLDYPGVGPEHAWLKDSGRAQYVGITDEEAL
KAFHDCCRIEGIIPALESSHAIAYGVKLAPTLPKDKILLVNLSGRGDKDMHTVAERSGIT
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgccagtccgcgcggcgggcgccgggaatcgagagcccggcgcgccgcgtggtcgaacc
gagagtgacgtcatgtataaccttcccgatgatcgcggccatttcggcccatatggcggc
gtgtttgtcgccgaaacgctgattcacgcgctcgacgagctgcgtgccgcgtacgagaaa
ttcaagaacgaccccgagttcgtcgccgaatacaaccgtgagctgaagcacttcgtcggc
cgtccgtcgccgatctatcacgcgcagcgctggagcgagacgctcggcggcgcgcagatc
tacctgaagcgcgaggacctgaaccacacgggcgcgcacaaggtgaacaacgtgatcggc
caggcgctgctcgccaagcgcatgggcaagcggcgcgtgatcgccgagacgggcgcgggc
cagcacggcgtcgccaccgcgacgatctgcgcgcgcttcggcatggagtgcgtcgtctac
atgggcgccgaggacgtgcgtcggcaggccgcgaacgtctaccggatgaagctgctcggc
gcgaccgtcgtgcccgtcgaatccggctcgcgcacgctgaaggatgcgttgaacgaggcg
atgcgcgactgggtcacgaacatcgagcgcacgttctacatcatcggcacggtggcgggc
ccgcatccgtatccgatgatggtgcgcgacttccagcgcgtgatcggcgacgaatgcaag
gtgcagatgcccgagctcgccggccggcagcccgacgcggtgatcgcctgcgtcggcggc
ggctcgaacgcgatgggcatcttctacccgtacatcgacgacgcggccgtccaattgatc
ggcgtcgaggcggcgggcgacgggctcgacaccggccatcacgcggcgtcgctgatcgcc
ggcagcccgggcgtgctgcacggcaaccgcacgtatctgctgcaggacgacgacggccag
atcatcgagacgcattcggtatcggccggcctcgactatccgggcgtcggccccgagcat
gcctggctgaaggacagcggccgcgcgcagtacgtcgggatcaccgacgaagaggcgctg
aaggcgtttcacgactgctgccggatcgaggggatcattcccgcgctcgaatcgagccac
gcgatcgcctacggcgtgaagctcgcgccgacgctgccgaaggacaagatcctcctcgtc
aacctgtcggggcgcggcgacaaggacatgcacacggtcgccgagcgatcgggcatcacg
ctctga

DBGET integrated database retrieval system