KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A0806Help
Entry
BURPS1710b_A0806  CDS       T00289                                 

Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:bpm00350]
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:bpm00740]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1059574..1061181)
Genome map
AA seq 535 aa AA seqDB search
MSNVNAPRVRRSVRDLQKLYDNGEKKPLEDLVRAWAGIQALPPSDPKSFFALGGYHGEPF
QYRKPVDALPQSDIYPYWGGYCNHGNVLFPTWHRMYVYKLEEALQSIVPGVSMPFWDETD
EYTLRHGIPSILTQETFELDGTPIDNPLRSFVLPDALSDRLPGDGSIYEKPKGYLTVRYP
LSGLVGTPEALEQTKLHNAKFPLPEKNTELLNGNVRAWLRGDSPTPDDPDPTRNGVYAKY
VRCLSAPNYTVFSNTTSASVWSSSNPGLVTAVESPHNDIHLAVGGFDYGGGETGQIAGAN
GDMGENNTAGMDPIFFFHHCNVDRMFWVWQKQTGHTDRLDIIRNYPGTNASDSQGPTPGF
APGESLNLKTPLNPFKKASGEAYTSEDCINIERQLGFTYGPGSLDDVTPELKSLLAVPSG
NSTKKLTVTGIDRALIQGSFIMKAYASVTDANGKTREYYLGHKSILSRWNVVHCANCLTH
LDVVAHFPLSAMPADDVPKAEFRVKIIHRGGGVPSASKAAIGVVSGLQPNFEVSD
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgtcaatgcaccgagggtgcgccggtcggtgcgcgatcttcagaagctgtac
gacaacggggagaagaagccgctcgaggatctcgtgcgcgcgtgggcgggcattcaggcg
ttgccgccgtcggatccgaaatcgttcttcgcgctcggcggctatcacggcgagccgttc
cagtatcgcaagcctgtcgacgcgctgccgcagagcgacatctatccgtactggggcggt
tactgcaaccacggcaacgtattgttcccgacctggcaccggatgtatgtctacaagctc
gaggaagcgctgcagagcatcgtgcccggcgtatcgatgccgttctgggacgagaccgac
gaatacacgctgcggcatggcattccgtcgatcctgacgcaggagacattcgaactggac
ggcacgccgatcgacaatccgctgcgctcgttcgtgctgcccgatgcgctatcggatcgc
ctgccgggcgacggcagcatctatgagaagccgaagggatatttgacggtgcgctatccg
ctgtcgggcctcgtcggcacgccggaggcgctcgagcagacgaagctgcacaacgcgaag
ttcccgctgccggagaagaacaccgaactgttgaacggcaacgtgagggcatggctgagg
ggcgattcgccgacgccggacgatcccgatccgacacgcaacggcgtctatgcgaaatat
gtccgctgcctgtccgcgccgaactacacggtgttttccaacacgacgtccgcatcggta
tggagcagctcgaacccggggctcgtcacggccgtcgaatcgccgcacaacgacatccac
ctggccgtcggcggcttcgattacggcggcggcgaaaccgggcagatcgccggcgcgaac
ggcgacatgggcgagaacaacacggccggcatggatccgatctttttcttccatcactgc
aacgtcgaccgtatgttctgggtctggcagaagcagacgggccacaccgatcgtctcgac
atcatccgcaactatccgggcacgaacgcgagcgattcgcagggcccgacgccgggtttc
gcgccgggcgagtcgctcaatctgaagacgccgctcaatccgttcaagaaggccagcggc
gaagcgtacacgtccgaggactgcatcaacatcgagcggcagctcggcttcacgtacggc
ccgggctcgctcgacgacgtcacgcccgagctgaagtcgctgctcgccgtgccgagcggc
aacagcacgaagaagctgacggtgacgggcatcgaccgggcgctgattcaaggctcgttc
atcatgaaggcgtatgcgagcgtgacggacgcgaacggcaagacgcgcgaatactacctc
gggcacaagtcgatcctgagccgctggaatgtcgtgcattgcgcgaattgcctgacgcat
ctggatgtcgtcgcgcatttcccgctgagcgcgatgccggcggacgacgtgccgaaggcg
gaattccgggtgaaaatcatccatcgcggcggcggcgtgccgagcgcgtcgaaggcggcg
atcggtgtggtgtccgggctgcagccgaacttcgaggtgagcgactga

DBGET integrated database retrieval system