KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A0806Help
Entry
BURPS1710b_A0806  CDS       T00289                                 

Definition
tyrosinase
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    BURPS1710b_A0806
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BURPS1710b_A0806
Enzymes [BR:bpm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     BURPS1710b_A0806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1059574..1061181)
Genome map
AA seq 535 aa AA seqDB search
MSNVNAPRVRRSVRDLQKLYDNGEKKPLEDLVRAWAGIQALPPSDPKSFFALGGYHGEPF
QYRKPVDALPQSDIYPYWGGYCNHGNVLFPTWHRMYVYKLEEALQSIVPGVSMPFWDETD
EYTLRHGIPSILTQETFELDGTPIDNPLRSFVLPDALSDRLPGDGSIYEKPKGYLTVRYP
LSGLVGTPEALEQTKLHNAKFPLPEKNTELLNGNVRAWLRGDSPTPDDPDPTRNGVYAKY
VRCLSAPNYTVFSNTTSASVWSSSNPGLVTAVESPHNDIHLAVGGFDYGGGETGQIAGAN
GDMGENNTAGMDPIFFFHHCNVDRMFWVWQKQTGHTDRLDIIRNYPGTNASDSQGPTPGF
APGESLNLKTPLNPFKKASGEAYTSEDCINIERQLGFTYGPGSLDDVTPELKSLLAVPSG
NSTKKLTVTGIDRALIQGSFIMKAYASVTDANGKTREYYLGHKSILSRWNVVHCANCLTH
LDVVAHFPLSAMPADDVPKAEFRVKIIHRGGGVPSASKAAIGVVSGLQPNFEVSD
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacgtcaatgcaccgagggtgcgccggtcggtgcgcgatcttcagaagctgtac
gacaacggggagaagaagccgctcgaggatctcgtgcgcgcgtgggcgggcattcaggcg
ttgccgccgtcggatccgaaatcgttcttcgcgctcggcggctatcacggcgagccgttc
cagtatcgcaagcctgtcgacgcgctgccgcagagcgacatctatccgtactggggcggt
tactgcaaccacggcaacgtattgttcccgacctggcaccggatgtatgtctacaagctc
gaggaagcgctgcagagcatcgtgcccggcgtatcgatgccgttctgggacgagaccgac
gaatacacgctgcggcatggcattccgtcgatcctgacgcaggagacattcgaactggac
ggcacgccgatcgacaatccgctgcgctcgttcgtgctgcccgatgcgctatcggatcgc
ctgccgggcgacggcagcatctatgagaagccgaagggatatttgacggtgcgctatccg
ctgtcgggcctcgtcggcacgccggaggcgctcgagcagacgaagctgcacaacgcgaag
ttcccgctgccggagaagaacaccgaactgttgaacggcaacgtgagggcatggctgagg
ggcgattcgccgacgccggacgatcccgatccgacacgcaacggcgtctatgcgaaatat
gtccgctgcctgtccgcgccgaactacacggtgttttccaacacgacgtccgcatcggta
tggagcagctcgaacccggggctcgtcacggccgtcgaatcgccgcacaacgacatccac
ctggccgtcggcggcttcgattacggcggcggcgaaaccgggcagatcgccggcgcgaac
ggcgacatgggcgagaacaacacggccggcatggatccgatctttttcttccatcactgc
aacgtcgaccgtatgttctgggtctggcagaagcagacgggccacaccgatcgtctcgac
atcatccgcaactatccgggcacgaacgcgagcgattcgcagggcccgacgccgggtttc
gcgccgggcgagtcgctcaatctgaagacgccgctcaatccgttcaagaaggccagcggc
gaagcgtacacgtccgaggactgcatcaacatcgagcggcagctcggcttcacgtacggc
ccgggctcgctcgacgacgtcacgcccgagctgaagtcgctgctcgccgtgccgagcggc
aacagcacgaagaagctgacggtgacgggcatcgaccgggcgctgattcaaggctcgttc
atcatgaaggcgtatgcgagcgtgacggacgcgaacggcaagacgcgcgaatactacctc
gggcacaagtcgatcctgagccgctggaatgtcgtgcattgcgcgaattgcctgacgcat
ctggatgtcgtcgcgcatttcccgctgagcgcgatgccggcggacgacgtgccgaaggcg
gaattccgggtgaaaatcatccatcgcggcggcggcgtgccgagcgcgtcgaaggcggcg
atcggtgtggtgtccgggctgcagccgaacttcgaggtgagcgactga

DBGET integrated database retrieval system