KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A0879Help
Entry
BURPS1710b_A0879  CDS       T00289                                 

Definition
alpha amylase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BURPS1710b_A0879
Enzymes [BR:bpm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BURPS1710b_A0879
Exosome [BR:bpm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BURPS1710b_A0879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1140195..1141838)
Genome map
AA seq 547 aa AA seqDB search
MSECPHDPYAQHHSHCLPFGAQPCGAAGATTRTHFRVWAPAHAAVTLALDTAGGLHELPM
APAGDGWFETFADCGAHTRYRYRLDEALTIPDPASRSQPEGADGPSEVIDPRAFTWRHTF
WRGRPWEEIALYAIQPGAAGGYDGVRERLPQLAQLGVTALELLAAPQARDDSLPFAPIAA
YGGVDALKRLIDEAHGFGLAVLLDLDYARFGCGSDEMRRYAQPFFHTRDDPLQAPPLALD
HPQVCDFFCDNALYWLEEYRCDGLRIREADRIDSAWLREIADRVHAAMPTDRIVHLVLGS
ERHPSHLADTHFDAQWNGCGERALYRLTGRRDRAHGDGVSTHQSIHALARALTANGAVFQ
RAHPAGEGGMADVGLPLTSLVLSDGVVRDAREADLAALALSLLTPQIPLIFDEAAGDASR
RHFVQSALAVRAKLIAPRLIDVRPRRADMLRAADGVEADALVAAWRLGDGETLSIALNLS
PQALPFHGAPDGTIVFETPARARDRVDAGVLPPYALVAWLTGDVNQYALTHDVRRYADVA
PHSPGGA
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaatgtcctcatgatccgtatgcgcagcatcactcgcattgcctgccgttcggc
gcccagccctgcggcgccgcgggcgcgacgacacgcactcactttcgcgtctgggcgccc
gcgcatgcggccgtgacgctcgcgctcgacaccgcgggcggcctgcatgaattgccgatg
gcgcccgcgggcgacggctggttcgagacgttcgccgattgcggcgcgcatacgcgctac
cggtatcggctcgacgaggcgctgacgatccccgatccggcgtcgcgctcgcagccggaa
ggcgccgacgggccgagcgaggtgatcgatccgcgcgcgttcacgtggcgccacacgttc
tggcgtggcaggccgtgggaggagatcgcgctctacgcgatccagcccggcgcggcgggc
ggttacgacggtgtccgtgagcgcttgccgcagctcgcgcagttgggcgtcaccgcgctc
gagttgctcgcggcgccgcaggcgcgcgacgacagcctgccgttcgcgccgatcgccgca
tacggcggcgtcgacgcgctcaagcgcctgatcgacgaggcgcacggtttcggcctcgcg
gtgctgctcgatctcgactatgcgcgcttcggctgcggctccgatgaaatgcggcgctac
gcgcagccgttcttccacacccgcgacgatccgctgcaggcgccgccgctcgcgctcgac
cacccgcaggtgtgcgacttcttctgcgacaacgcgctgtactggctcgaagaatatcga
tgcgacggcttgcggatccgcgaggcggaccgcatcgacagcgcgtggctgcgcgagatc
gccgatcgcgtgcacgcggcgatgccgaccgaccggatcgtgcatctcgtgctcggcagc
gagcggcatccgtcgcacctcgccgacacgcatttcgacgcgcaatggaacggttgcggc
gagcgcgcgctgtaccggctgacggggcgccgcgatcgcgcgcacggcgacggcgtgtcg
acgcatcagtcgatccatgcgctcgcgcgcgcgttgaccgcgaacggcgcggtgttccag
cgcgcgcatccggccggcgaaggcgggatggccgacgtcggcctgccgctgacctcgctc
gtgctgtccgacggcgtcgtgcgcgacgcgcgcgaggcggatctcgcggcgctcgcgctg
tcgctgctgacgccgcagattccgctgatcttcgatgaagccgcgggcgacgcgtcgcgg
cgccatttcgtgcaatcggcgctcgcggtgcgcgcgaagctgatcgcgccgcgcctgatc
gacgtgcggccgcgccgcgccgacatgctgcgcgcggccgacggcgtcgaggccgatgcg
cttgttgccgcatggcggctcggcgacggcgagacgctcagcatcgcgctgaacctgtcg
ccgcaggcgttgccgtttcatggcgcgccggacggaacgatcgtgttcgaaacgccggcg
cgcgcgcgggatcgcgtcgacgcgggtgtgctgccgccgtatgcgcttgtcgcgtggctg
acgggcgacgtcaatcagtacgcgctgacgcacgatgtgcgtcgttacgcggatgtcgcc
ccgcactcgccgggcggcgcttga

DBGET integrated database retrieval system