KEGG   Burkholderia pseudomallei 1710b: BURPS1710b_A0963Help
Entry
BURPS1710b_A0963  CDS       T00289                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
bpm  Burkholderia pseudomallei 1710b
Pathway
Two-component system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bpm02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1224206..1225234)
Genome map
AA seq 342 aa AA seqDB search
MNIGIVNDLPLAVEALRRTIALRPEHRVLWVATDGAQALDFCVAQPPDLVLMDLVMPRID
GVSATRSIMERSPCAILIVTANVGANASYVYEAMGAGALDAVDTPTLEQGGSADPSQPLL
AKIDQIGRLLATRMPLAAPAAAAPAPQGALPPLVAIGASAGGPTALTALLRRLPDDFPAA
LVIVQHVDQAFAIGMAQWLDGYSPLPVRIARQGSVPQAGEVLLAATNDHLHLTSRGVLAY
TRRPEETPYRPSVDVFFHSVVDHWKGEAIGVLLTGMGRDGALGLKAMRTKGHYTIAQDEA
TSAVYGMPKAAAAIGAASAVLPLERIADQLISLVQRNRQRWR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcggcatcgtcaacgacttgccgctcgccgtcgaggcgctgcgccgcacgatc
gcgctgcggcccgagcaccgcgtgctgtgggtcgcgacggacggcgcgcaggcgctcgac
ttctgcgtcgcgcagccgccggacctcgtcctgatggatctcgtgatgccgcgcatcgac
ggcgtatcggcgacgcgcagcatcatggagcgctcgccgtgcgcgatcctcatcgtcacc
gcgaacgtcggcgcgaacgcgtcgtacgtctacgaggcgatgggcgcgggcgcgctcgac
gcggtcgacacgccgacgctcgagcagggcggcagcgccgatccgtcgcagccgctgctc
gcgaagatcgaccagatcggccggctgctcgcgacgcgtatgccgctcgccgcgcccgcc
gccgccgcgcccgcgccgcagggcgcgttgccgccgctcgtcgcgatcggcgcgtcggcg
ggcgggccgaccgcgctgaccgcgctgctgcggcggctgccggacgattttccggcggcg
ctcgtgatcgtccagcatgtcgaccaggcgttcgcgatcggcatggcgcagtggctcgac
ggctattcgccgttgccggtgcgcatcgcgcggcagggcagcgtgccgcaggcgggcgag
gtgctgctcgcggcgaccaacgatcacctgcatctgacgtcgcgcggggtgctcgcgtac
acgcggcggccggaagagacgccgtaccggccgtcggtcgacgtgttctttcacagtgtc
gtcgatcactggaagggcgaggcgatcggcgtgctgctcacgggcatggggcgcgacggc
gcgctcggcctgaaggcgatgcgcacgaaggggcattacacgatcgcgcaggacgaagcg
acgagcgcggtgtacgggatgccgaaggccgcggccgcgatcggcgcggcgagcgcggtg
ctgccgctcgagcggatcgccgatcagttgatctcgctcgttcagcgcaacaggcagcgc
tggcgctga

DBGET integrated database retrieval system